|
LmjF.01.0610 | LmjF.01.0610:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1173 | LmjF.01.0610 | DNA-damage inducible protein DDI1-like protein | DNA-damage inducible protein DDI1-like protein | | E9AC52 | 1 | LmjF.01:171,562..172,734(+) | LmjF.01:171562..172734(+) | LmjF.01 | Leishmania major strain Friedlin | 50 | OG6_101685 | 0 | 390 | 1173 | 41684 | 5.37 | 0 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005654 | nucleoplasm | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.01.0610ORDNA-damage inducible protein DDI1-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.01.0610 OR DNA-damage inducible protein DDI1-like protein AND Leishmania major strain Friedlin |
|
LmjF.01.0650 | LmjF.01.0650:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1485 | LmjF.01.0650 | mitochondrial-processing peptidase subunit beta, putative | mitochondrial-processing peptidase subunit beta, putative | | E9AC56 | 1 | LmjF.01:185,785..187,269(+) | LmjF.01:185785..187269(+) | LmjF.01 | Leishmania major strain Friedlin | 49 | OG6_100777 | 0 | 494 | 1485 | 55078 | 6.56 | 0 | NN: MLRRTSAVAATAALPHNMTMKDPLCQQVLSRCTPVVYSA, HMM: MLRRTSAVAATAALPHNMTM | NN Sum: 1, NN D: .17, HMM Prob: .56 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0020023;GO:0017087;GO:0005739 | kinetoplast;mitochondrial processing peptidase complex;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0030150 | protein import into mitochondrial matrix | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.01.0650ORmitochondrial-processing peptidase subunit beta, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.01.0650 OR mitochondrial-processing peptidase subunit beta, putative AND Leishmania major strain Friedlin |
|
LmjF.01.0830 | LmjF.01.0830:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2037 | LmjF.01.0830 | metallo-peptidase, Clan MA(E), Family M3 | metallo-peptidase, Clan MA(E), Family M3 | | E9AC74 | 1 | LmjF.01:258,831..260,867(+) | LmjF.01:258831..260867(+) | LmjF.01 | Leishmania major strain Friedlin | 117 | OG6_100561 | 3 | 678 | 2037 | 76002 | 6.01 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.15.- (Peptidyl-dipeptidases.) | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.01.0830ORmetallo-peptidase, Clan MA(E), Family M3ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.01.0830 OR metallo-peptidase, Clan MA(E), Family M3 AND Leishmania major strain Friedlin |
|
LmjF.02.0040 | LmjF.02.0040:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1860 | LmjF.02.0040 | Xaa-Pro aminopeptidase, putative | Xaa-Pro aminopeptidase, putative | | E9AC78 | 2 | LmjF.02:11,678..13,537(-) | LmjF.02:11678..13537(-) | LmjF.02 | Leishmania major strain Friedlin | 60 | OG6_100896 | 1 | 619 | 1860 | 68953 | 6.21 | 0 | HMM: MIMKASGAAVLHAVREKMQEATVAALIVTSSDAH, NN: MIMKASGAAVLHAVREKMQEATVAAL | NN Sum: 0, NN D: .15, HMM Prob: .54 | | | GO:0016787 | hydrolase activity | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.02.0040ORXaa-Pro aminopeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.02.0040 OR Xaa-Pro aminopeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.02.0710 | LmjF.02.0710:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2454 | LmjF.02.0710 | ATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putative | ATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putative | | E9ACE5 | 2 | LmjF.02:344,949..347,402(+) | LmjF.02:344949..347402(+) | LmjF.02 | Leishmania major strain Friedlin | 140 | OG6_100223 | 2 | 817 | 2454 | 90899 | 6.96 | 0 | NN: MLRRCLAQASTALRCGSTAALAA, HMM: MLRRCLAQASTALRCGSTAALAA | NN Sum: 2, NN D: .42, HMM Prob: .99 | | | GO:0005524 | ATP binding | | | GO:0005739 | mitochondrion | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.02.0710ORATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.02.0710 OR ATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putative AND Leishmania major strain Friedlin |
|
LmjF.02.0740 | LmjF.02.0740:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2037 | LmjF.02.0740 | dipeptylcarboxypeptidase, putative | dipeptylcarboxypeptidase, putative | | E9ACE8 | 2 | LmjF.02:351,494..353,530(+) | LmjF.02:351494..353530(+) | LmjF.02 | Leishmania major strain Friedlin | 117 | OG6_100561 | 3 | 678 | 2037 | 76567 | 6.06 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | GO:0008241 | peptidyl-dipeptidase activity | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.02.0740ORdipeptylcarboxypeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.02.0740 OR dipeptylcarboxypeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.03.0540 | LmjF.03.0540:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1191 | LmjF.03.0540 | 26S protease regulatory subunit, putative | 26S protease regulatory subunit, putative | | E9ACJ9 | 3 | LmjF.03:201,954..203,144(+) | LmjF.03:201954..203144(+) | LmjF.03 | Leishmania major strain Friedlin | 52 | OG6_101751 | 0 | 396 | 1191 | 44411 | 9.15 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005838 | proteasome regulatory particle | | | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.03.0540OR26S protease regulatory subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.03.0540 OR 26S protease regulatory subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.04.0450 | LmjF.04.0450:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2565 | LmjF.04.0450 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | Q9U0T9 | 4 | LmjF.04:173,211..175,775(-) | LmjF.04:173211..175775(-) | LmjF.04 | Leishmania major strain Friedlin | 136 | OG6_127587 | 2 | 854 | 2565 | 94270 | 4.52 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.04.0450ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.04.0450 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania major strain Friedlin |
|
LmjF.04.0850 | LmjF.04.0850:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1203 | LmjF.04.0850 | serine peptidase, Clan S-, family S54, putative | serine peptidase, Clan S-, family S54, putative | | Q9U0Z8 | 4 | LmjF.04:331,841..333,043(-) | LmjF.04:331841..333043(-) | LmjF.04 | Leishmania major strain Friedlin | 48 | OG6_147170 | 0 | 400 | 1203 | 43771 | 7.92 | 4 | HMM: MQQPCFFAARCGAQRISRLATAAAATVSSSPAIMRCA, NN: MQQPCFFAARCGAQRISRLATAA | NN Sum: 0, NN D: .25, HMM Prob: .82 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0031966 | mitochondrial membrane | | | GO:0030150 | protein import into mitochondrial matrix | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.04.0850ORserine peptidase, Clan S-, family S54, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.04.0850 OR serine peptidase, Clan S-, family S54, putative AND Leishmania major strain Friedlin |
|
LmjF.05.0950 | LmjF.05.0950:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2724 | LmjF.05.0950 | glutaminyl cyclase, putative | glutaminyl cyclase, putative | | Q4QJA7 | 5 | LmjF.05:352,756..355,479(+) | LmjF.05:352756..355479(+) | LmjF.05 | Leishmania major strain Friedlin | 55 | OG6_151075 | 0 | 907 | 2724 | 101790 | 7.87 | 1 | | | | | | | | | | | | | | | 2.3.2.5 (Glutaminyl-peptide cyclotransferase) | 2.3.2.5 (Glutaminyl-peptide cyclotransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.05.0950ORglutaminyl cyclase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.05.0950 OR glutaminyl cyclase, putative AND Leishmania major strain Friedlin |
|
LmjF.05.0960 | LmjF.05.0960:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2040 | LmjF.05.0960 | metallo-peptidase, Clan M-, Family M49 | metallo-peptidase, Clan M-, Family M49 | | Q4QJA6 | 5 | LmjF.05:356,672..358,711(+) | LmjF.05:356672..358711(+) | LmjF.05 | Leishmania major strain Friedlin | 28 | OG6_103290 | 0 | 679 | 2040 | 75967 | 5.12 | 0 | | | GO:0005737 | cytoplasm | GO:0008239 | dipeptidyl-peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.14.4 (Dipeptidyl-peptidase III) | 3.4.14.4 (Dipeptidyl-peptidase III) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.05.0960ORmetallo-peptidase, Clan M-, Family M49ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.05.0960 OR metallo-peptidase, Clan M-, Family M49 AND Leishmania major strain Friedlin |
|
LmjF.06.0140 | LmjF.06.0140:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 744 | LmjF.06.0140 | 20S proteasome beta 6 subunit, putative | 20S proteasome beta 6 subunit, putative | | Q4QJ65 | 6 | LmjF.06:52,926..53,669(-) | LmjF.06:52926..53669(-) | LmjF.06 | Leishmania major strain Friedlin | 52 | OG6_101631 | 0 | 247 | 744 | 27966 | 7.02 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.06.0140OR20S proteasome beta 6 subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.06.0140 OR 20S proteasome beta 6 subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.06.0340 | LmjF.06.0340:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2718 | LmjF.06.0340 | serine peptidase, clan SC, family S9A-like protein | serine peptidase, clan SC, family S9A-like protein | | Q4QJ45 | 6 | LmjF.06:115,615..118,332(-) | LmjF.06:115615..118332(-) | LmjF.06 | Leishmania major strain Friedlin | 107 | OG6_102873 | 1 | 905 | 2718 | 104012 | 6.29 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | | 3.4.21.83 (Oligopeptidase B) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.06.0340ORserine peptidase, clan SC, family S9A-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.06.0340 OR serine peptidase, clan SC, family S9A-like protein AND Leishmania major strain Friedlin |
|
LmjF.07.0030 | LmjF.07.0030:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 831 | LmjF.07.0030 | hypothetical protein, conserved | hypothetical protein, conserved | | Q4QIU1 | 7 | LmjF.07:14,183..15,013(+) | LmjF.07:14183..15013(+) | LmjF.07 | Leishmania major strain Friedlin | 13 | OG6_478828 | 0 | 276 | 831 | 30571 | 8.21 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.07.0030ORhypothetical protein, conservedANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.07.0030 OR hypothetical protein, conserved AND Leishmania major strain Friedlin |
|
LmjF.07.0100 | LmjF.07.0100:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 3099 | LmjF.07.0100 | metallo-peptidase, Clan ME, Family M16C | metallo-peptidase, Clan ME, Family M16C | | Q4QIT4 | 7 | LmjF.07:34,567..37,665(+) | LmjF.07:34567..37665(+) | LmjF.07 | Leishmania major strain Friedlin | 51 | OG6_101809 | 0 | 1032 | 3099 | 115677 | 6.19 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.07.0100ORmetallo-peptidase, Clan ME, Family M16CANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.07.0100 OR metallo-peptidase, Clan ME, Family M16C AND Leishmania major strain Friedlin |
|
LmjF.07.0270 | LmjF.07.0270:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1194 | LmjF.07.0270 | acetylornithine deacetylase-like protein | acetylornithine deacetylase-like protein | | Q4QIR7 | 7 | LmjF.07:107,093..108,286(-) | LmjF.07:107093..108286(-) | LmjF.07 | Leishmania major strain Friedlin | 697 | OG6_100626 | 1 | 397 | 1194 | 42842 | 5.82 | 0 | | | GO:0005737 | cytoplasm | GO:0008777;GO:0016787 | acetylornithine deacetylase activity;hydrolase activity | GO:0006526;GO:0008152 | arginine biosynthetic process;metabolic process | | | | | | | 3.5.1.16 (Acetylornithine deacetylase) | 3.5.1.16 (Acetylornithine deacetylase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.07.0270ORacetylornithine deacetylase-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.07.0270 OR acetylornithine deacetylase-like protein AND Leishmania major strain Friedlin |
|
LmjF.07.0370 | LmjF.07.0370:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2772 | LmjF.07.0370 | Zinc finger, C3HC4 type (RING finger), putative | Zinc finger, C3HC4 type (RING finger), putative | | Q4QIQ6 | 7 | LmjF.07:168,105..170,876(-) | LmjF.07:168105..170876(-) | LmjF.07 | Leishmania major strain Friedlin | 22 | OG6_166659 | 0 | 923 | 2772 | 96400 | 8.08 | 0 | | | | | GO:0046872;GO:0005515;GO:0008270 | metal ion binding;protein binding;zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.07.0370ORZinc finger, C3HC4 type (RING finger), putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.07.0370 OR Zinc finger, C3HC4 type (RING finger), putative AND Leishmania major strain Friedlin |
|
LmjF.07.1120 | LmjF.07.1120:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1041 | LmjF.07.1120 | proteasome regulatory non-ATP-ase subunit, putative | proteasome regulatory non-ATP-ase subunit, putative | | Q4QIH4 | 7 | LmjF.07:564,202..565,242(+) | LmjF.07:564202..565242(+) | LmjF.07 | Leishmania major strain Friedlin | 49 | OG6_102002 | 0 | 346 | 1041 | 36374 | 4.03 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0005654;GO:0000502;GO:0005838 | ciliary plasm;cytoplasm;nucleoplasm;proteasome complex;proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.07.1120ORproteasome regulatory non-ATP-ase subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.07.1120 OR proteasome regulatory non-ATP-ase subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.08.0230 | LmjF.08.0230:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1569 | LmjF.08.0230 | ABC1 family, putative | ABC1 family, putative | | Q4QIE6 | 8 | LmjF.08:86,331..87,899(+) | LmjF.08:86331..87899(+) | LmjF.08 | Leishmania major strain Friedlin | 108 | OG6_100510 | 1 | 522 | 1569 | 58667 | 6.93 | 0 | HMM: MTFRFSRAARYGAAAAGFMGTSTAA, NN: MTFRFSRAARYGAAAAGFMGTSTAA | NN Sum: 3, NN D: .43, HMM Prob: .7 | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.08.0230ORABC1 family, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.08.0230 OR ABC1 family, putative AND Leishmania major strain Friedlin |
|
LmjF.08.0450 | LmjF.08.0450:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 543 | LmjF.08.0450 | signal peptidase type I, putative | signal peptidase type I, putative | | Q4QIC4 | 8 | LmjF.08:185,817..186,359(+) | LmjF.08:185817..186359(+) | LmjF.08 | Leishmania major strain Friedlin | 48 | OG6_100807 | 0 | 180 | 543 | 20639 | 6.60 | 0 | NN: MREHIDTLLSLRIRDVVQQVVTISLFLSVVLVGWRGAA, HMM: MREHIDTLLSLRIRDVVQQVVTISLFLSVVLVGWRGAA | NN Sum: 3, NN D: .45, HMM Prob: .03 | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783 | endoplasmic reticulum | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.08.0450ORsignal peptidase type I, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.08.0450 OR signal peptidase type I, putative AND Leishmania major strain Friedlin |
|
LmjF.08.1010 | LmjF.08.1010:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1047 | LmjF.08.1010 | cysteine peptidase B (CPB) | cysteine peptidase B (CPB) | | Q4QI68 | 8 | LmjF.08:458,886..459,932(-) | LmjF.08:458886..459932(-) | LmjF.08 | Leishmania major strain Friedlin | 540 | OG6_100116 | 8 | 348 | 1047 | 37926 | 7.45 | 1 | NN: MATSRAALCAVAVVCVVLAAACAPARAI, HMM: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | GO:0008234 | cysteine-type peptidase activity | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.08.1010ORcysteine peptidase B (CPB)ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.08.1010 OR cysteine peptidase B (CPB) AND Leishmania major strain Friedlin |
|
LmjF.08.1020 | LmjF.08.1020:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1047 | LmjF.08.1020 | cathepsin L-like protease | cathepsin L-like protease | | Q4QI67 | 8 | LmjF.08:461,651..462,697(-) | LmjF.08:461651..462697(-) | LmjF.08 | Leishmania major strain Friedlin | 540 | OG6_100116 | 8 | 348 | 1047 | 37770 | 6.77 | 1 | NN: MATSRAALCAVAVVCVVLAAACAPARAI, HMM: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.08.1020ORcathepsin L-like proteaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.08.1020 OR cathepsin L-like protease AND Leishmania major strain Friedlin |
|
LmjF.08.1030 | LmjF.08.1030:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1332 | LmjF.08.1030 | cathepsin L-like protease | cathepsin L-like protease | | Q4QI66 | 8 | LmjF.08:464,139..465,470(-) | LmjF.08:464139..465470(-) | LmjF.08 | Leishmania major strain Friedlin | 540 | OG6_100116 | 8 | 443 | 1332 | 48057 | 7.84 | 1 | HMM: MATSRAALCAVAVVCVVLAAACAPARAI, NN: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.08.1030ORcathepsin L-like proteaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.08.1030 OR cathepsin L-like protease AND Leishmania major strain Friedlin |
|
LmjF.08.1040 | LmjF.08.1040:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1047 | LmjF.08.1040 | cathepsin L-like protease | cathepsin L-like protease | | Q4QI65 | 8 | LmjF.08:467,201..468,247(-) | LmjF.08:467201..468247(-) | LmjF.08 | Leishmania major strain Friedlin | 540 | OG6_100116 | 8 | 348 | 1047 | 37799 | 7.20 | 1 | NN: MATSRAALCAVAVVCVVLAAACAPARAI, HMM: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.08.1040ORcathepsin L-like proteaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.08.1040 OR cathepsin L-like protease AND Leishmania major strain Friedlin |
|
LmjF.08.1050 | LmjF.08.1050:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1047 | LmjF.08.1050 | cathepsin L-like protease | cathepsin L-like protease | | Q4QI64 | 8 | LmjF.08:469,964..471,010(-) | LmjF.08:469964..471010(-) | LmjF.08 | Leishmania major strain Friedlin | 540 | OG6_100116 | 8 | 348 | 1047 | 37800 | 6.77 | 1 | NN: MATSRAALCAVAVVCVVLAAACAPARAI, HMM: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.08.1050ORcathepsin L-like proteaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.08.1050 OR cathepsin L-like protease AND Leishmania major strain Friedlin |
|
LmjF.08.1060 | LmjF.08.1060:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1332 | LmjF.08.1060 | cathepsin L-like protease | cathepsin L-like protease | | Q4QI61 | 8 | LmjF.08:472,445..473,776(-) | LmjF.08:472445..473776(-) | LmjF.08 | Leishmania major strain Friedlin | 540 | OG6_100116 | 8 | 443 | 1332 | 48029 | 7.84 | 1 | NN: MATSRAALCAVAVVCVVLAAACAPARAI, HMM: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.08.1060ORcathepsin L-like proteaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.08.1060 OR cathepsin L-like protease AND Leishmania major strain Friedlin |
|
LmjF.08.1070 | LmjF.08.1070:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1047 | LmjF.08.1070 | cathepsin L-like protease | cathepsin L-like protease | | Q4QI62 | 8 | LmjF.08:475,508..476,554(-) | LmjF.08:475508..476554(-) | LmjF.08 | Leishmania major strain Friedlin | 540 | OG6_100116 | 8 | 348 | 1047 | 37830 | 6.77 | 1 | NN: MATSRAALCAVAVVCVVLAAACAPARAI, HMM: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .82, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.08.1070ORcathepsin L-like proteaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.08.1070 OR cathepsin L-like protease AND Leishmania major strain Friedlin |
|
LmjF.08.1080 | LmjF.08.1080:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1698 | LmjF.08.1080 | cathepsin L-like protease | cathepsin L-like protease | | Q4QI61 | 8 | LmjF.08:477,996..479,693(-) | LmjF.08:477996..479693(-) | LmjF.08 | Leishmania major strain Friedlin | 540 | OG6_100116 | 8 | 565 | 1698 | 61367 | 8.48 | 1 | | | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.08.1080ORcathepsin L-like proteaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.08.1080 OR cathepsin L-like protease AND Leishmania major strain Friedlin |
|
LmjF.09.0240 | LmjF.09.0240:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2847 | LmjF.09.0240 | cysteine peptidase, Clan CA, family C19, putative | cysteine peptidase, Clan CA, family C19, putative | | Q4QI02 | 9 | LmjF.09:98,817..101,663(+) | LmjF.09:98817..101663(+) | LmjF.09 | Leishmania major strain Friedlin | 50 | OG6_103732 | 0 | 948 | 2847 | 104894 | 7.01 | 0 | HMM: MHLRVLPRCRRTTTSYLLLIMSATAASSR, NN: MHLRVLPRCRRTTTSYLLLIMSATAASSR | NN Sum: 4, NN D: .54, HMM Prob: .94 | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737;GO:0005741 | cytoplasm;mitochondrial outer membrane | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.09.0240ORcysteine peptidase, Clan CA, family C19, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.09.0240 OR cysteine peptidase, Clan CA, family C19, putative AND Leishmania major strain Friedlin |
|
LmjF.09.0600 | LmjF.09.0600:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1008 | LmjF.09.0600 | cyclin 1 | cyclin 1 | | Q4QHW4 | 9 | LmjF.09:247,294..248,301(+) | LmjF.09:247294..248301(+) | LmjF.09 | Leishmania major strain Friedlin | 51 | OG6_127800 | 0 | 335 | 1008 | 35762 | 6.31 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.09.0600ORcyclin 1ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.09.0600 OR cyclin 1 AND Leishmania major strain Friedlin |
|
LmjF.09.0770 | LmjF.09.0770:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2196 | LmjF.09.0770 | oligopeptidase b | oligopeptidase b | | Q4QHU7 | 9 | LmjF.09:318,935..321,130(-) | LmjF.09:318935..321130(-) | LmjF.09 | Leishmania major strain Friedlin | 107 | OG6_102873 | 1 | 731 | 2196 | 83002 | 5.78 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0070012 | oligopeptidase activity | | | 3.4.21.83 (Oligopeptidase B) | 3.4.21.83 (Oligopeptidase B) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.09.0770ORoligopeptidase bANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.09.0770 OR oligopeptidase b AND Leishmania major strain Friedlin |
|
LmjF.09.1300 | LmjF.09.1300:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 657 | LmjF.09.1300 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | Q4QHP5 | 9 | LmjF.09:504,512..505,168(-) | LmjF.09:504512..505168(-) | LmjF.09 | Leishmania major strain Friedlin | 124 | OG6_101256 | 1 | 218 | 657 | 24345 | 6.50 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.09.1300ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.09.1300 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania major strain Friedlin |
|
LmjF.09.1310 | LmjF.09.1310:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 765 | LmjF.09.1310 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | Q4QHP4 | 9 | LmjF.09:507,076..507,840(-) | LmjF.09:507076..507840(-) | LmjF.09 | Leishmania major strain Friedlin | 18 | OG6_199733 | 0 | 254 | 765 | 28363 | 7.27 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.09.1310ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.09.1310 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania major strain Friedlin |
|
LmjF.10.0460 | LmjF.10.0460:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1809 | LmjF.10.0460 | GP63, leishmanolysin | GP63, leishmanolysin | | Q4QHH2 | 10 | LmjF.10:213,345..215,153(+) | LmjF.10:213345..215153(+) | LmjF.10 | Leishmania major strain Friedlin | 619 | OG6_101754 | 4 | 602 | 1809 | 63938 | 6.83 | 1 | HMM: MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAAWAHAG, NN: MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAA | NN Sum: 2, NN D: .37, HMM Prob: .96 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | GO:0008160 | protein tyrosine phosphatase activator activity | GO:0044081;GO:0075130 | modulation by symbiont of host nitric oxide-mediated signal transduction;modulation by symbiont of host protein kinase-mediated signal transduction | 3.4.24.36 (Leishmanolysin) | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.10.0460ORGP63, leishmanolysinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.10.0460 OR GP63, leishmanolysin AND Leishmania major strain Friedlin |
|
LmjF.10.0465 | LmjF.10.0465:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1809 | LmjF.10.0465 | GP63, leishmanolysin | GP63, leishmanolysin | | Q4QHH1 | 10 | LmjF.10:216,396..218,204(+) | LmjF.10:216396..218204(+) | LmjF.10 | Leishmania major strain Friedlin | 619 | OG6_101754 | 4 | 602 | 1809 | 63968 | 6.74 | 1 | HMM: MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAAWAHAG, NN: MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAA | NN Sum: 2, NN D: .37, HMM Prob: .96 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | GO:0008160 | protein tyrosine phosphatase activator activity | GO:0044081;GO:0075130 | modulation by symbiont of host nitric oxide-mediated signal transduction;modulation by symbiont of host protein kinase-mediated signal transduction | 3.4.24.36 (Leishmanolysin) | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.10.0465ORGP63, leishmanolysinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.10.0465 OR GP63, leishmanolysin AND Leishmania major strain Friedlin |
|
LmjF.10.0470 | LmjF.10.0470:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1935 | LmjF.10.0470 | GP63, leishmanolysin | GP63, leishmanolysin | | Q4QHH0 | 10 | LmjF.10:219,443..221,377(+) | LmjF.10:219443..221377(+) | LmjF.10 | Leishmania major strain Friedlin | 619 | OG6_101754 | 4 | 644 | 1935 | 69277 | 5.97 | 2 | NN: MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAA, HMM: MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAAWAHAG | NN Sum: 2, NN D: .37, HMM Prob: .96 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | GO:0008160 | protein tyrosine phosphatase activator activity | GO:0044081;GO:0075130 | modulation by symbiont of host nitric oxide-mediated signal transduction;modulation by symbiont of host protein kinase-mediated signal transduction | 3.4.24.3 (Microbial collagenase);3.4.24.36 (Leishmanolysin) | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.10.0470ORGP63, leishmanolysinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.10.0470 OR GP63, leishmanolysin AND Leishmania major strain Friedlin |
|
LmjF.10.0480 | LmjF.10.0480:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1809 | LmjF.10.0480 | GP63, leishmanolysin | GP63, leishmanolysin | | Q4QHG9 | 10 | LmjF.10:223,401..225,209(+) | LmjF.10:223401..225209(+) | LmjF.10 | Leishmania major strain Friedlin | 619 | OG6_101754 | 4 | 602 | 1809 | 64039 | 6.74 | 1 | HMM: MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAAWAHAG, NN: MSVDSSSTHRRRCVAARLVRLAAAGAAVTVAVGTAAA | NN Sum: 2, NN D: .37, HMM Prob: .96 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | GO:0008160 | protein tyrosine phosphatase activator activity | GO:0044081;GO:0075130 | modulation by symbiont of host nitric oxide-mediated signal transduction;modulation by symbiont of host protein kinase-mediated signal transduction | 3.4.24.36 (Leishmanolysin) | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.10.0480ORGP63, leishmanolysinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.10.0480 OR GP63, leishmanolysin AND Leishmania major strain Friedlin |
|
LmjF.11.0240 | LmjF.11.0240:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 744 | LmjF.11.0240 | proteasome alpha 7 subunit, putative | proteasome alpha 7 subunit, putative | | Q4QH56 | 11 | LmjF.11:62,870..63,613(+) | LmjF.11:62870..63613(+) | LmjF.11 | Leishmania major strain Friedlin | 49 | OG6_101207 | 0 | 247 | 744 | 27786 | 6.06 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.11.0240ORproteasome alpha 7 subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.11.0240 OR proteasome alpha 7 subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.11.0620 | LmjF.11.0620:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 879 | LmjF.11.0620 | metallo-peptidase, Clan MF, Family M17 | metallo-peptidase, Clan MF, Family M17 | | Q4QH18 | 11 | LmjF.11:233,088..233,966(+) | LmjF.11:233088..233966(+) | LmjF.11 | Leishmania major strain Friedlin | 1 | OG6_478894 | 0 | 292 | 879 | 31229 | 6.34 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | 3.4.11.- (Aminopeptidases.) | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.11.0620ORmetallo-peptidase, Clan MF, Family M17ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.11.0620 OR metallo-peptidase, Clan MF, Family M17 AND Leishmania major strain Friedlin |
|
LmjF.11.0630 | LmjF.11.0630:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1617 | LmjF.11.0630 | metallo-peptidase, Clan MF, Family M17 | metallo-peptidase, Clan MF, Family M17 | | Q4QH17 | 11 | LmjF.11:236,568..238,184(+) | LmjF.11:236568..238184(+) | LmjF.11 | Leishmania major strain Friedlin | 68 | OG6_142599 | 0 | 538 | 1617 | 57147 | 6.37 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | 3.4.11.- (Aminopeptidases.) | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.11.0630ORmetallo-peptidase, Clan MF, Family M17ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.11.0630 OR metallo-peptidase, Clan MF, Family M17 AND Leishmania major strain Friedlin |
|
LmjF.11.0720 | LmjF.11.0720:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1962 | LmjF.11.0720 | PUF nine target 1 | PUF nine target 1 | | Q4QH06 | 11 | LmjF.11:292,776..294,737(+) | LmjF.11:292776..294737(+) | LmjF.11 | Leishmania major strain Friedlin | 54 | OG6_146977 | 0 | 653 | 1962 | 71138 | 9.11 | 0 | NN: MPPKRYPNRLLVLCASINDVTAW, HMM: MPPKRYPNRLLVLCASINDVTAW | NN Sum: 2, NN D: .38, HMM Prob: .98 | | | | | | | GO:0020023 | kinetoplast | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.11.0720ORPUF nine target 1ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.11.0720 OR PUF nine target 1 AND Leishmania major strain Friedlin |
|
LmjF.12.0030 | LmjF.12.0030:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 852 | LmjF.12.0030 | proteasome beta-1 subunit, putative | proteasome beta-1 subunit, putative | | Q4QGU1 | 12 | LmjF.12:5,193..6,044(+) | LmjF.12:5193..6044(+) | LmjF.12 | Leishmania major strain Friedlin | 51 | OG6_101390 | 0 | 283 | 852 | 30329 | 7.26 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.12.0030ORproteasome beta-1 subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.12.0030 OR proteasome beta-1 subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.12.0190 | LmjF.12.0190:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4872 | LmjF.12.0190 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | Q4QGS4 | 12 | LmjF.12:59,661..64,532(+) | LmjF.12:59661..64532(+) | LmjF.12 | Leishmania major strain Friedlin | 26 | OG6_199649 | 0 | 1623 | 4872 | 170767 | 6.78 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.12.0190ORubiquitin hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.12.0190 OR ubiquitin hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.12.0210 | LmjF.12.0210:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1236 | LmjF.12.0210 | proteasome regulatory ATPase subunittcc1l8.3, putative | proteasome regulatory ATPase subunittcc1l8.3, putative | | Q4QGS2 | 12 | LmjF.12:72,525..73,760(+) | LmjF.12:72525..73760(+) | LmjF.12 | Leishmania major strain Friedlin | 53 | OG6_101965 | 0 | 411 | 1236 | 45864 | 8.29 | 0 | NN: MAASSVASVSATKASALAA, HMM: MAASSVASVSATKASAL | NN Sum: 0, NN D: .09, HMM Prob: .63 | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005838 | proteasome regulatory particle | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.12.0210ORproteasome regulatory ATPase subunittcc1l8.3, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.12.0210 OR proteasome regulatory ATPase subunittcc1l8.3, putative AND Leishmania major strain Friedlin |
|
LmjF.12.0240 | LmjF.12.0240:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2115 | LmjF.12.0240 | hypothetical protein, unknown function | hypothetical protein, unknown function | | Q4QGR9 | 12 | LmjF.12:81,928..84,042(+) | LmjF.12:81928..84042(+) | LmjF.12 | Leishmania major strain Friedlin | 44 | OG6_139763 | 0 | 704 | 2115 | 74755 | 7.67 | 2 | HMM: MVYRTLVASMAPTRHCAASVAPMCLADRMKQRCRCRLSPLLMCAVLFAQLLLCSTSLPVAAD, NN: MVYRTLVASMAPTRHCAASVAPMCLADRMKQRCRCRLSPLLMCAVLFAQLLLCSTSLPVAAD | NN Sum: 3, NN D: .36, HMM Prob: .78 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.12.0240ORhypothetical protein, unknown functionANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.12.0240 OR hypothetical protein, unknown function AND Leishmania major strain Friedlin |
|
LmjF.12.1250 | LmjF.12.1250:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4116 | LmjF.12.1250 | puromycin-sensitive aminopeptidase-like protein | puromycin-sensitive aminopeptidase-like protein | | Q4QGG4 | 12 | LmjF.12:636,454..640,569(+) | LmjF.12:636454..640569(+) | LmjF.12 | Leishmania major strain Friedlin | 46 | OG6_156775 | 0 | 1371 | 4116 | 149571 | 6.92 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.12.1250ORpuromycin-sensitive aminopeptidase-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.12.1250 OR puromycin-sensitive aminopeptidase-like protein AND Leishmania major strain Friedlin |
|
LmjF.12.1330 | LmjF.12.1330:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1863 | LmjF.12.1330 | Alpha/beta hydrolase domain-containing protein | Alpha/beta hydrolase domain-containing protein | | Q4QGF5 | 12 | LmjF.12:663,848..665,710(+) | LmjF.12:663848..665710(+) | LmjF.12 | Leishmania major strain Friedlin | 86 | OG6_100915 | 1 | 620 | 1863 | 69426 | 6.96 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.12.1330ORAlpha/beta hydrolase domain-containing proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.12.1330 OR Alpha/beta hydrolase domain-containing protein AND Leishmania major strain Friedlin |
|
LmjF.13.0090 | LmjF.13.0090:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1512 | LmjF.13.0090 | metallo-peptidase, Clan MA(E) Family M32 | metallo-peptidase, Clan MA(E) Family M32 | | Q4QGE5 | 13 | LmjF.13:23,388..24,899(-) | LmjF.13:23388..24899(-) | LmjF.13 | Leishmania major strain Friedlin | 152 | OG6_105939 | 3 | 503 | 1512 | 57032 | 5.81 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.13.0090ORmetallo-peptidase, Clan MA(E) Family M32ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.13.0090 OR metallo-peptidase, Clan MA(E) Family M32 AND Leishmania major strain Friedlin |
|
LmjF.13.0680 | LmjF.13.0680:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1725 | LmjF.13.0680 | Metallopeptidase family M24, putative | Metallopeptidase family M24, putative | | Q4QG86 | 13 | LmjF.13:219,784..221,508(+) | LmjF.13:219784..221508(+) | LmjF.13 | Leishmania major strain Friedlin | 49 | OG6_146697 | 0 | 574 | 1725 | 61673 | 9.46 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.13.0680ORMetallopeptidase family M24, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.13.0680 OR Metallopeptidase family M24, putative AND Leishmania major strain Friedlin |
|
LmjF.13.0870 | LmjF.13.0870:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1587 | LmjF.13.0870 | mitochondrial processing peptidase alpha subunit, putative | mitochondrial processing peptidase alpha subunit, putative | | Q4QG67 | 13 | LmjF.13:296,601..298,187(-) | LmjF.13:296601..298187(-) | LmjF.13 | Leishmania major strain Friedlin | 51 | OG6_146937 | 0 | 528 | 1587 | 57749 | 7.85 | 0 | HMM: MLRRVVAPAPVSATAACAGQAR, NN: MLRRVVAPAPVSATAACAGQARSI | NN Sum: 1, NN D: .3, HMM Prob: .95 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005739 | mitochondrion | | | | | 3.4.24.6 (Leucolysin);3.4.99.41 (Transferred entry: 3.4.24.64) | 3.4.99.41 (Transferred entry: 3.4.24.64) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.13.0870ORmitochondrial processing peptidase alpha subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.13.0870 OR mitochondrial processing peptidase alpha subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.13.1040 | LmjF.13.1040:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 5169 | LmjF.13.1040 | subtilisin peptidase | subtilisin peptidase | | Q4QG50 | 13 | LmjF.13:352,320..357,488(-) | LmjF.13:352320..357488(-) | LmjF.13 | Leishmania major strain Friedlin | 53 | OG6_136864 | 0 | 1722 | 5169 | 182739 | 8.29 | 2 | HMM: MMMEVVVALRLLTIHVLAALLLVLWSLPLAEGP, NN: MMMEVVVALRLLTIHVLAALLLVLWSLPLAEGP | NN Sum: 4, NN D: .82, HMM Prob: .99 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | GO:0004252 | serine-type endopeptidase activity | GO:0030154;GO:0045454;GO:0009405;GO:0016485;GO:2000377 | cell differentiation;cell redox homeostasis;pathogenesis;protein processing;regulation of reactive oxygen species metabolic process | | 3.4.21.112 (Site-1 protease) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.13.1040ORsubtilisin peptidaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.13.1040 OR subtilisin peptidase AND Leishmania major strain Friedlin |
|
LmjF.13.1090 | LmjF.13.1090:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1317 | LmjF.13.1090 | proteasome regulatory ATPase subunit 2, putative | proteasome regulatory ATPase subunit 2, putative | | Q4QG45 | 13 | LmjF.13:383,248..384,564(-) | LmjF.13:383248..384564(-) | LmjF.13 | Leishmania major strain Friedlin | 54 | OG6_101477 | 0 | 438 | 1317 | 49289 | 5.60 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654;GO:0005838 | cytoplasm;nucleoplasm;proteasome regulatory particle | | | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.13.1090ORproteasome regulatory ATPase subunit 2, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.13.1090 OR proteasome regulatory ATPase subunit 2, putative AND Leishmania major strain Friedlin |
|
LmjF.13.1140 | LmjF.13.1140:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1212 | LmjF.13.1140 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | Q4QG40 | 13 | LmjF.13:398,421..399,632(-) | LmjF.13:398421..399632(-) | LmjF.13 | Leishmania major strain Friedlin | 52 | OG6_101420 | 0 | 403 | 1212 | 43633 | 7.23 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.13.1140ORAlpha/beta hydrolase family, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.13.1140 OR Alpha/beta hydrolase family, putative AND Leishmania major strain Friedlin |
|
LmjF.14.0180 | LmjF.14.0180:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1515 | LmjF.14.0180 | carboxypeptidase, putative | carboxypeptidase, putative | | Q4QFW7 | 14 | LmjF.14:46,644..48,158(+) | LmjF.14:46644..48158(+) | LmjF.14 | Leishmania major strain Friedlin | 152 | OG6_105939 | 3 | 504 | 1515 | 57082 | 5.99 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.17.19 (Carboxypeptidase Taq) | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.14.0180ORcarboxypeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.14.0180 OR carboxypeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.14.0310 | LmjF.14.0310:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 858 | LmjF.14.0310 | proteasome alpha 3 subunit, putative | proteasome alpha 3 subunit, putative | | Q4QFV4 | 14 | LmjF.14:85,092..85,949(+) | LmjF.14:85092..85949(+) | LmjF.14 | Leishmania major strain Friedlin | 50 | OG6_101968 | 0 | 285 | 858 | 32139 | 5.22 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.14.0310ORproteasome alpha 3 subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.14.0310 OR proteasome alpha 3 subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.15.0090 | LmjF.15.0090:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1446 | LmjF.15.0090 | ATP-dependent protease ATPase subunit HslU1, putative | ATP-dependent protease ATPase subunit HslU1, putative | | Q4QFH5 | 15 | LmjF.15:27,722..29,167(-) | LmjF.15:27722..29167(-) | LmjF.15 | Leishmania major strain Friedlin | 50 | OG6_106348 | 0 | 481 | 1446 | 53110 | 7.62 | 0 | NN: MHRALSLSCRSSVAATGAASSHTLLTGVRCCSTAAAAAAA, HMM: MHRALSLSCRSSVAATGAASSHTLLTGVRCCSTAAAAAAAPAPAA | NN Sum: 0, NN D: .28, HMM Prob: .99 | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | GO:0009376;GO:0005737;GO:0042645 | HslUV protease complex;cytoplasm;mitochondrial nucleoid | | | GO:0006264;GO:0070581 | mitochondrial DNA replication;rolling circle DNA replication | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.15.0090ORATP-dependent protease ATPase subunit HslU1, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.15.0090 OR ATP-dependent protease ATPase subunit HslU1, putative AND Leishmania major strain Friedlin |
|
LmjF.15.0580 | LmjF.15.0580:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 975 | LmjF.15.0580 | signal peptidase subunit, putative | signal peptidase subunit, putative | | Q4QFC7 | 15 | LmjF.15:240,381..241,355(+) | LmjF.15:240381..241355(+) | LmjF.15 | Leishmania major strain Friedlin | 27 | OG6_165119 | 0 | 324 | 975 | 36427 | 9.26 | 1 | NN: MHSMRQRSCDIFASTVSALLVTAVLTA, HMM: MHSMRQRSCDIFASTVSALLVTAVLTA | NN Sum: 3, NN D: .52, HMM Prob: .63 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.15.0580ORsignal peptidase subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.15.0580 OR signal peptidase subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.15.1300 | LmjF.15.1300:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 4239 | LmjF.15.1300 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | Q4QF52 | 15 | LmjF.15:538,932..543,170(-) | LmjF.15:538932..543170(-) | LmjF.15 | Leishmania major strain Friedlin | 52 | OG6_145141 | 0 | 1412 | 4239 | 155042 | 5.50 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.15.1300ORubiquitin hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.15.1300 OR ubiquitin hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.15.1530 | LmjF.15.1530:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1059 | LmjF.15.1530 | presenilin-like aspartic peptidase, clan AD, family A22A, putative | presenilin-like aspartic peptidase, clan AD, family A22A, putative | | Q4QF26 | 15 | LmjF.15:609,696..610,754(-) | LmjF.15:609696..610754(-) | LmjF.15 | Leishmania major strain Friedlin | 49 | OG6_101989 | 0 | 352 | 1059 | 38657 | 7.19 | 7 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | GO:0016485 | protein processing | GO:0005737 | cytoplasm | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.15.1530ORpresenilin-like aspartic peptidase, clan AD, family A22A, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.15.1530 OR presenilin-like aspartic peptidase, clan AD, family A22A, putative AND Leishmania major strain Friedlin |
|
LmjF.16.0290 | LmjF.16.0290:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 762 | LmjF.16.0290 | proteasome 26S non-ATPase subunit 9, putative | proteasome 26S non-ATPase subunit 9, putative | | Q4QEZ1 | 16 | LmjF.16:104,548..105,309(-) | LmjF.16:104548..105309(-) | LmjF.16 | Leishmania major strain Friedlin | 52 | OG6_102356 | 0 | 253 | 762 | 28013 | 4.65 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.16.0290ORproteasome 26S non-ATPase subunit 9, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.16.0290 OR proteasome 26S non-ATPase subunit 9, putative AND Leishmania major strain Friedlin |
|
LmjF.16.0730 | LmjF.16.0730:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 5700 | LmjF.16.0730 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | Q4QEU6 | 16 | LmjF.16:254,998..260,697(-) | LmjF.16:254998..260697(-) | LmjF.16 | Leishmania major strain Friedlin | 54 | OG6_154037 | 0 | 1899 | 5700 | 201074 | 6.44 | 0 | NN: MSACVTGTASAAQLGVGDLWASEVLEGCARAH, HMM: MSACVTGTASAAQLGVGDLWAS | NN Sum: 0, NN D: .14, HMM Prob: .59 | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737;GO:0031981;GO:0005634 | cytoplasm;nuclear lumen;nucleus | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.16.0730ORubiquitin hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.16.0730 OR ubiquitin hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.16.1385 | LmjF.16.1385:pseudogenic_transcript | 4 | 1 | 1 | | | reverse | protein coding | Yes | 2808 | LmjF.16.1385 | hypothetical protein, conserved | hypothetical protein, conserved | | | 16 | LmjF.16:575,232..578,044(-) | LmjF.16:575232..578044(-) | LmjF.16 | Leishmania major strain Friedlin | 0 | N/A (orthology not determined because poor protein quality) | 0 | 936 | 2808 | 96519 | 8.28 | 0 | | | | | | | | | | | | | | | | 4.6.1.1 (Adenylate cyclase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.16.1385ORhypothetical protein, conservedANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.16.1385 OR hypothetical protein, conserved AND Leishmania major strain Friedlin |
|
LmjF.16.1550 | LmjF.16.1550:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 3711 | LmjF.16.1550 | hypothetical protein, conserved | hypothetical protein, conserved | | Q4QEL0 | 16 | LmjF.16:656,946..660,656(+) | LmjF.16:656946..660656(+) | LmjF.16 | Leishmania major strain Friedlin | 51 | OG6_102663 | 0 | 1236 | 3711 | 139312 | 6.47 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005930;GO:0005737 | axoneme;cytoplasm | | | GO:0060285 | cilium-dependent cell motility | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.16.1550ORhypothetical protein, conservedANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.16.1550 OR hypothetical protein, conserved AND Leishmania major strain Friedlin |
|
LmjF.17.0140 | LmjF.17.0140:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1272 | LmjF.17.0140 | peptidase T, putative, metallo-peptidase, ClanMH, family M20B | peptidase T, putative, metallo-peptidase, ClanMH, family M20B | | Q4QEH4 | 17 | LmjF.17:106,813..108,084(-) | LmjF.17:106813..108084(-) | LmjF.17 | Leishmania major strain Friedlin | 53 | OG6_111055 | 0 | 423 | 1272 | 46848 | 6.19 | 0 | | | GO:0005737 | cytoplasm | GO:0016787;GO:0045148;GO:0008270 | hydrolase activity;tripeptide aminopeptidase activity;zinc ion binding | GO:0008152;GO:0006518 | metabolic process;peptide metabolic process | | | | | | | 3.4.11.14 (Cytosol alanyl aminopeptidase) | 3.4.11.4 (Tripeptide aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.17.0140ORpeptidase T, putative, metallo-peptidase, ClanMH, family M20BANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.17.0140 OR peptidase T, putative, metallo-peptidase, ClanMH, family M20B AND Leishmania major strain Friedlin |
|
LmjF.17.1090 | LmjF.17.1090:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 3933 | LmjF.17.1090 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | | Q4QE82 | 17 | LmjF.17:532,905..536,837(+) | LmjF.17:532905..536837(+) | LmjF.17 | Leishmania major strain Friedlin | 25 | OG6_199796 | 0 | 1310 | 3933 | 139973 | 6.49 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005634 | nucleus | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.17.1090ORPeptidase C19, ubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.17.1090 OR Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.17.1110 | LmjF.17.1110:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4293 | LmjF.17.1110 | kinesin, putative | kinesin, putative | | Q4QE80 | 17 | LmjF.17:540,178..544,470(+) | LmjF.17:540178..544470(+) | LmjF.17 | Leishmania major strain Friedlin | 54 | OG6_146515 | 0 | 1430 | 4293 | 158164 | 6.65 | 0 | | | | | GO:0005524;GO:0005488;GO:0008017;GO:0003777;GO:0005515 | ATP binding;binding;microtubule binding;microtubule motor activity;protein binding | GO:0007018 | microtubule-based movement | GO:0005930;GO:0097542 | axoneme;ciliary tip | | | GO:0010608 | posttranscriptional regulation of gene expression | 3.6.4.4 (Transferred entry: 5.6.1.3) | 3.6.4.4 (Transferred entry: 5.6.1.3) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.17.1110ORkinesin, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.17.1110 OR kinesin, putative AND Leishmania major strain Friedlin |
|
LmjF.17.1290 | LmjF.17.1290:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2130 | LmjF.17.1290 | eukaryotic translation initiation factor 3 subunit b | eukaryotic translation initiation factor 3 subunit b | | Q4QE62 | 17 | LmjF.17:614,550..616,679(+) | LmjF.17:614550..616679(+) | LmjF.17 | Leishmania major strain Friedlin | 55 | OG6_101924 | 0 | 709 | 2130 | 80758 | 8.01 | 0 | | | | | | | | | GO:0005737;GO:0005852 | cytoplasm;eukaryotic translation initiation factor 3 complex | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.17.1290OReukaryotic translation initiation factor 3 subunit bANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.17.1290 OR eukaryotic translation initiation factor 3 subunit b AND Leishmania major strain Friedlin |
|
LmjF.17.1400 | LmjF.17.1400:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 813 | LmjF.17.1400 | otubain cysteine peptidase, Clan CA, family C65, putative | otubain cysteine peptidase, Clan CA, family C65, putative | | Q4QE49 | 17 | LmjF.17:652,372..653,184(+) | LmjF.17:652372..653184(+) | LmjF.17 | Leishmania major strain Friedlin | 51 | OG6_102549 | 0 | 270 | 813 | 30180 | 4.37 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.17.1400ORotubain cysteine peptidase, Clan CA, family C65, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.17.1400 OR otubain cysteine peptidase, Clan CA, family C65, putative AND Leishmania major strain Friedlin |
|
LmjF.18.0360 | LmjF.18.0360.2:mRNA | 2 | 1 | 2 | | 133 | reverse | protein coding | No | 1207 | LmjF.18.0360 | GPI-anchor transamidase subunit 8 (GPI8), putative | GPI-anchor transamidase subunit 8 (GPI8), putative | | Q4QE06 | 18 | LmjF.18:146,659..147,865(-) | LmjF.18:146659..147732(-) | LmjF.18 | Leishmania major strain Friedlin | 48 | OG6_101767 | 0 | 357 | 1074 | 39774 | 5.69 | 1 | HMM: MTSPTRFTATALLVVALLVLTASSCF, NN: MTSPTRFTATALLVVALLVLTASSCFPDAYAA | NN Sum: 4, NN D: .75, HMM Prob: 1 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | GO:0005783;GO:0005635 | endoplasmic reticulum;nuclear envelope | GO:0003923 | GPI-anchor transamidase activity | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.18.0360ORGPI-anchor transamidase subunit 8 (GPI8), putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.18.0360 OR GPI-anchor transamidase subunit 8 (GPI8), putative AND Leishmania major strain Friedlin |
|
LmjF.18.0450 | LmjF.18.0450:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1389 | LmjF.18.0450 | serine carboxypeptidase (CBP1), putative | serine carboxypeptidase (CBP1), putative | | Q4QDZ7 | 18 | LmjF.18:192,734..194,122(-) | LmjF.18:192734..194122(-) | LmjF.18 | Leishmania major strain Friedlin | 158 | OG6_100109 | 0 | 462 | 1389 | 51772 | 5.12 | 1 | HMM: MASFLSTTALLVALLVAMVPWACVPTVYAS, NN: MASFLSTTALLVALLVAMVPWACVPTVYAS | NN Sum: 4, NN D: .84, HMM Prob: 1 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.16.5 (Carboxypeptidase C) | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.18.0450ORserine carboxypeptidase (CBP1), putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.18.0450 OR serine carboxypeptidase (CBP1), putative AND Leishmania major strain Friedlin |
|
LmjF.18.0610 | LmjF.18.0610:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1797 | LmjF.18.0610 | ATP-dependent zinc metallopeptidase, putative | ATP-dependent zinc metallopeptidase, putative | | Q4QDY0 | 18 | LmjF.18:258,115..259,911(+) | LmjF.18:258115..259911(+) | LmjF.18 | Leishmania major strain Friedlin | 50 | OG6_139899 | 0 | 598 | 1797 | 64909 | 6.32 | 1 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.18.0610ORATP-dependent zinc metallopeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.18.0610 OR ATP-dependent zinc metallopeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.18.1060 | LmjF.18.1060:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2325 | LmjF.18.1060 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | Q4QDT6 | 18 | LmjF.18:450,158..452,482(+) | LmjF.18:450158..452482(+) | LmjF.18 | Leishmania major strain Friedlin | 39 | OG6_158065 | 0 | 774 | 2325 | 86059 | 5.85 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.18.1060ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.18.1060 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania major strain Friedlin |
|
LmjF.18.1320 | LmjF.18.1320:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4410 | LmjF.18.1320 | hypothetical protein, conserved | hypothetical protein, conserved | | Q4QDQ7 | 18 | LmjF.18:558,187..562,596(+) | LmjF.18:558187..562596(+) | LmjF.18 | Leishmania major strain Friedlin | 53 | OG6_156926 | 0 | 1469 | 4410 | 160274 | 6.46 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.18.1320ORhypothetical protein, conservedANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.18.1320 OR hypothetical protein, conserved AND Leishmania major strain Friedlin |
|
LmjF.19.0130 | LmjF.19.0130:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 762 | LmjF.19.0130 | Der1-like family, putative | Der1-like family, putative | | Q4QDK8 | 19 | LmjF.19:24,025..24,786(-) | LmjF.19:24025..24786(-) | LmjF.19 | Leishmania major strain Friedlin | 95 | OG6_101672 | 1 | 253 | 762 | 28337 | 8.49 | 4 | HMM: MSQNFGDWFNQLGLVTRASLVASVGLSAACSL, NN: MSQNFGDWFNQLGLVTRASLVASVGLSAACSL | NN Sum: 1, NN D: .38, HMM Prob: .56 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.19.0130ORDer1-like family, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.19.0130 OR Der1-like family, putative AND Leishmania major strain Friedlin |
|
LmjF.19.0160 | LmjF.19.0160:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1143 | LmjF.19.0160 | metallo-peptidase, Clan MG, Family M24 | metallo-peptidase, Clan MG, Family M24 | | Q4QDK5 | 19 | LmjF.19:33,351..34,493(-) | LmjF.19:33351..34493(-) | LmjF.19 | Leishmania major strain Friedlin | 52 | OG6_101895 | 0 | 380 | 1143 | 42519 | 5.85 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.19.0160ORmetallo-peptidase, Clan MG, Family M24ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.19.0160 OR metallo-peptidase, Clan MG, Family M24 AND Leishmania major strain Friedlin |
|
LmjF.19.0550 | LmjF.19.0550:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1206 | LmjF.19.0550 | metallo- peptidase, Clan MG, Family M24 | metallo- peptidase, Clan MG, Family M24 | | Q4QDG7 | 19 | LmjF.19:206,074..207,279(+) | LmjF.19:206074..207279(+) | LmjF.19 | Leishmania major strain Friedlin | 55 | OG6_100342 | 0 | 401 | 1206 | 44866 | 6.39 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.19.0550ORmetallo- peptidase, Clan MG, Family M24ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.19.0550 OR metallo- peptidase, Clan MG, Family M24 AND Leishmania major strain Friedlin |
|
LmjF.19.1420 | LmjF.19.1420:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1065 | LmjF.19.1420 | cysteine peptidase A (CPA) | cysteine peptidase A (CPA) | | Q4QD68 | 19 | LmjF.19:621,270..622,334(+) | LmjF.19:621270..622334(+) | LmjF.19 | Leishmania major strain Friedlin | 540 | OG6_100116 | 8 | 354 | 1065 | 38958 | 6.95 | 1 | HMM: MARRNPFLFAIVVTILFVVCYGSAL, NN: MARRNPFLFAIVVTILFVVCYGSAL | NN Sum: 4, NN D: .84, HMM Prob: .7 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.19.1420ORcysteine peptidase A (CPA)ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.19.1420 OR cysteine peptidase A (CPA) AND Leishmania major strain Friedlin |
|
LmjF.19.1590 | LmjF.19.1590:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1797 | LmjF.19.1590 | ATP-dependent zinc metallopeptidase, putative | ATP-dependent zinc metallopeptidase, putative | | Q4QD50 | 19 | LmjF.19:680,419..682,215(+) | LmjF.19:680419..682215(+) | LmjF.19 | Leishmania major strain Friedlin | 67 | OG6_139691 | 0 | 598 | 1797 | 64528 | 7.15 | 1 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.19.1590ORATP-dependent zinc metallopeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.19.1590 OR ATP-dependent zinc metallopeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.19.1630 | LmjF.19.1630:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 378 | LmjF.19.1630 | ATG8/AUT7/APG8/PAZ2, putative | ATG8/AUT7/APG8/PAZ2, putative | | Q4QD46 | 19 | LmjF.19:687,260..687,637(+) | LmjF.19:687260..687637(+) | LmjF.19 | Leishmania major strain Friedlin | 66 | OG6_100707 | 0 | 125 | 378 | 13943 | 7.51 | 0 | | | | | | | | | | | | | GO:0010506 | regulation of autophagy | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.19.1630ORATG8/AUT7/APG8/PAZ2, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.19.1630 OR ATG8/AUT7/APG8/PAZ2, putative AND Leishmania major strain Friedlin |
|
LmjF.20.1180 | LmjF.20.1180:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2931 | LmjF.20.1180 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | Q4QCS9 | 20 | LmjF.20:531,127..534,057(+) | LmjF.20:531127..534057(+) | LmjF.20 | Leishmania major strain Friedlin | 136 | OG6_127587 | 2 | 976 | 2931 | 107641 | 4.04 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53);3.4.22.5 (Transferred entry: 3.4.22.33) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.20.1180ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.20.1180 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.20.1185 | LmjF.20.1185:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2472 | LmjF.20.1185 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | Q4QCS8 | 20 | LmjF.20:536,865..539,336(+) | LmjF.20:536865..539336(+) | LmjF.20 | Leishmania major strain Friedlin | 136 | OG6_127587 | 2 | 823 | 2472 | 91357 | 4.55 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53);3.4.22.5 (Transferred entry: 3.4.22.33) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.20.1185ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.20.1185 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.20.1190 | LmjF.20.1190:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2064 | LmjF.20.1190 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | Q4QCS7 | 20 | LmjF.20:541,963..544,026(+) | LmjF.20:541963..544026(+) | LmjF.20 | Leishmania major strain Friedlin | 50 | OG6_155901 | 0 | 687 | 2064 | 78273 | 4.80 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930;GO:0005737 | axoneme;cytoplasm | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.20.1190ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.20.1190 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania major strain Friedlin |
|
LmjF.20.1200 | LmjF.20.1200:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2232 | LmjF.20.1200 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | Q4QCS6 | 20 | LmjF.20:548,104..550,335(+) | LmjF.20:548104..550335(+) | LmjF.20 | Leishmania major strain Friedlin | 28 | OG6_199937 | 0 | 743 | 2232 | 82592 | 7.10 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.20.1200ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.20.1200 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.20.1210 | LmjF.20.1210:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1245 | LmjF.20.1210 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | Q4QCS5 | 20 | LmjF.20:555,012..556,256(+) | LmjF.20:555012..556256(+) | LmjF.20 | Leishmania major strain Friedlin | 36 | OG6_199938 | 0 | 414 | 1245 | 46231 | 7.89 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.20.1210ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.20.1210 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.20.1240 | LmjF.20.1240:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 8271 | LmjF.20.1240 | Raptor N-terminal CASPase like domain containing protein, putative | Raptor N-terminal CASPase like domain containing protein, putative | | Q4QCS2 | 20 | LmjF.20:564,823..573,093(+) | LmjF.20:564823..573093(+) | LmjF.20 | Leishmania major strain Friedlin | 55 | OG6_147359 | 0 | 2756 | 8271 | 294093 | 6.84 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.20.1240ORRaptor N-terminal CASPase like domain containing protein, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.20.1240 OR Raptor N-terminal CASPase like domain containing protein, putative AND Leishmania major strain Friedlin |
|
LmjF.20.1550 | LmjF.20.1550:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1206 | LmjF.20.1550 | amidohydrolase, putative | amidohydrolase, putative | | Q4QCM6 | 20 | LmjF.20:722,272..723,477(-) | LmjF.20:722272..723477(-) | LmjF.20 | Leishmania major strain Friedlin | 181 | OG6_101553 | 4 | 401 | 1206 | 43484 | 5.89 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0097014;GO:0005737;GO:0005654 | ciliary plasm;cytoplasm;nucleoplasm | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.20.1550ORamidohydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.20.1550 OR amidohydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.20.1560 | LmjF.20.1560:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1191 | LmjF.20.1560 | amidohydrolase, putative | amidohydrolase, putative | | Q4QCM5 | 20 | LmjF.20:724,572..725,762(-) | LmjF.20:724572..725762(-) | LmjF.20 | Leishmania major strain Friedlin | 181 | OG6_101553 | 4 | 396 | 1191 | 42829 | 5.39 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0097014;GO:0005737;GO:0005654 | ciliary plasm;cytoplasm;nucleoplasm | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.20.1560ORamidohydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.20.1560 OR amidohydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.20.1570 | LmjF.20.1570:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1185 | LmjF.20.1570 | amidohydrolase, putative | amidohydrolase, putative | | Q4QCM4 | 20 | LmjF.20:727,619..728,803(-) | LmjF.20:727619..728803(-) | LmjF.20 | Leishmania major strain Friedlin | 181 | OG6_101553 | 4 | 394 | 1185 | 42781 | 4.88 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0097014;GO:0005737;GO:0005654 | ciliary plasm;cytoplasm;nucleoplasm | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.20.1570ORamidohydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.20.1570 OR amidohydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.21.0120 | LmjF.21.0120:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4887 | LmjF.21.0120 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | Q4QCK4 | 21 | LmjF.21:33,215..38,101(+) | LmjF.21:33215..38101(+) | LmjF.21 | Leishmania major strain Friedlin | 54 | OG6_148289 | 0 | 1628 | 4887 | 180350 | 6.43 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930 | axoneme | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.21.0120ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.21.0120 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania major strain Friedlin |
|
LmjF.21.0340 | LmjF.21.0340:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1404 | LmjF.21.0340 | mitochondrial processing peptidase alpha subunit, putative | mitochondrial processing peptidase alpha subunit, putative | | Q4QCI1 | 21 | LmjF.21:112,309..113,712(+) | LmjF.21:112309..113712(+) | LmjF.21 | Leishmania major strain Friedlin | 44 | OG6_155541 | 0 | 467 | 1404 | 51408 | 7.77 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.21.0340ORmitochondrial processing peptidase alpha subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.21.0340 OR mitochondrial processing peptidase alpha subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.21.0400 | LmjF.21.0400:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2166 | LmjF.21.0400 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | | Q4QCH5 | 21 | LmjF.21:125,766..127,931(+) | LmjF.21:125766..127931(+) | LmjF.21 | Leishmania major strain Friedlin | 27 | OG6_101733 | 0 | 721 | 2166 | 78536 | 7.99 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | GO:0004197 | cysteine-type endopeptidase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.21.0400ORPeptidase C19, ubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.21.0400 OR Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.21.0840 | LmjF.21.0840:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1398 | LmjF.21.0840 | metallo-peptidase, Clan MG, Family M24 | metallo-peptidase, Clan MG, Family M24 | | Q4QCC5 | 21 | LmjF.21:307,359..308,756(+) | LmjF.21:307359..308756(+) | LmjF.21 | Leishmania major strain Friedlin | 52 | OG6_100815 | 0 | 465 | 1398 | 51230 | 7.00 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0008237 | metallopeptidase activity | GO:0006508 | proteolysis | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.21.0840ORmetallo-peptidase, Clan MG, Family M24ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.21.0840 OR metallo-peptidase, Clan MG, Family M24 AND Leishmania major strain Friedlin |
|
LmjF.21.1700 | LmjF.21.1700:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 696 | LmjF.21.1700 | proteasome alpha 2 subunit, putative | proteasome alpha 2 subunit, putative | | Q4QC13 | 21 | LmjF.21:727,900..728,595(-) | LmjF.21:727900..728595(-) | LmjF.21 | Leishmania major strain Friedlin | 49 | OG6_101969 | 0 | 231 | 696 | 25096 | 5.74 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737 | cytoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.21.1700ORproteasome alpha 2 subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.21.1700 OR proteasome alpha 2 subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.21.1830 | LmjF.21.1830:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 735 | LmjF.21.1830 | proteasome subunit alpha type-5, putative | proteasome subunit alpha type-5, putative | | Q4QC00 | 21 | LmjF.21:750,625..751,359(+) | LmjF.21:750625..751359(+) | LmjF.21 | Leishmania major strain Friedlin | 50 | OG6_101621 | 0 | 244 | 735 | 26784 | 5.18 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005829;GO:0005634;GO:0005839 | cytosol;nucleus;proteasome core complex | | | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.21.1830ORproteasome subunit alpha type-5, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.21.1830 OR proteasome subunit alpha type-5, putative AND Leishmania major strain Friedlin |
|
LmjF.22.0570 | LmjF.22.0570:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1314 | LmjF.22.0570 | proteasome regulatory ATPase subunit 1, putative | proteasome regulatory ATPase subunit 1, putative | | Q4QBU0 | 22 | LmjF.22:216,456..217,769(-) | LmjF.22:216456..217769(-) | LmjF.22 | Leishmania major strain Friedlin | 50 | OG6_101899 | 0 | 437 | 1314 | 49020 | 6.22 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.22.0570ORproteasome regulatory ATPase subunit 1, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.22.0570 OR proteasome regulatory ATPase subunit 1, putative AND Leishmania major strain Friedlin |
|
LmjF.22.0620 | LmjF.22.0620:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1335 | LmjF.22.0620 | proteasome regulatory ATPase subunit 5, putative | proteasome regulatory ATPase subunit 5, putative | | Q4QBT5 | 22 | LmjF.22:230,766..232,100(-) | LmjF.22:230766..232100(-) | LmjF.22 | Leishmania major strain Friedlin | 53 | OG6_101915 | 0 | 444 | 1335 | 49532 | 5.64 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.22.0620ORproteasome regulatory ATPase subunit 5, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.22.0620 OR proteasome regulatory ATPase subunit 5, putative AND Leishmania major strain Friedlin |
|
LmjF.23.0460 | LmjF.23.0460:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 798 | LmjF.23.0460 | trypanothione synthetase, putative | trypanothione synthetase, putative | | Q4QBC8 | 23 | LmjF.23:174,520..175,317(+) | LmjF.23:174520..175317(+) | LmjF.23 | Leishmania major strain Friedlin | 24 | OG6_173685 | 0 | 265 | 798 | 29291 | 9.07 | 0 | | | | | | | | | | | | | | | 6.3.1.9 (Trypanothione synthase) | 6.3.1.9 (Trypanothione synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.23.0460ORtrypanothione synthetase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.23.0460 OR trypanothione synthetase, putative AND Leishmania major strain Friedlin |
|
LmjF.23.0950 | LmjF.23.0950:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1698 | LmjF.23.0950 | cytosolic leucyl aminopeptidase | cytosolic leucyl aminopeptidase | | Q7KF27 | 23 | LmjF.23:457,238..458,935(-) | LmjF.23:457238..458935(-) | LmjF.23 | Leishmania major strain Friedlin | 53 | OG6_100682 | 0 | 565 | 1698 | 60266 | 9.51 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0030863 | cortical cytoskeleton | | | | | 3.4.11.1 (Leucyl aminopeptidase) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.23.0950ORcytosolic leucyl aminopeptidaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.23.0950 OR cytosolic leucyl aminopeptidase AND Leishmania major strain Friedlin |
|
LmjF.24.0420 | LmjF.24.0420:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 924 | LmjF.24.0420 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | Q4QAT9 | 24 | LmjF.24:137,490..138,413(+) | LmjF.24:137490..138413(+) | LmjF.24 | Leishmania major strain Friedlin | 53 | OG6_102753 | 0 | 307 | 924 | 34445 | 4.79 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.24.0420ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.24.0420 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.24.0620 | LmjF.24.0620:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2430 | LmjF.24.0620 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | Q4QAS1 | 24 | LmjF.24:216,854..219,283(+) | LmjF.24:216854..219283(+) | LmjF.24 | Leishmania major strain Friedlin | 50 | OG6_101457 | 0 | 809 | 2430 | 89604 | 9.13 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005634 | nucleus | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.24.0620ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.24.0620 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.24.0650 | LmjF.24.0650:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2994 | LmjF.24.0650 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | Q4QAR8 | 24 | LmjF.24:226,989..229,982(+) | LmjF.24:226989..229982(+) | LmjF.24 | Leishmania major strain Friedlin | 124 | OG6_101256 | 1 | 997 | 2994 | 105053 | 6.77 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.24.0650ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.24.0650 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania major strain Friedlin |
|
LmjF.25.0190 | LmjF.25.0190:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 702 | LmjF.25.0190 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | Q4QA77 | 25 | LmjF.25:58,187..58,888(-) | LmjF.25:58187..58888(-) | LmjF.25 | Leishmania major strain Friedlin | 49 | OG6_101218 | 0 | 233 | 702 | 25120 | 4.80 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.25.0190ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.25.0190 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.25.1480 | LmjF.25.1480:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2118 | LmjF.25.1480 | calpain family cysteine protease-like protein | calpain family cysteine protease-like protein | | Q4Q9U3 | 25 | LmjF.25:592,410..594,527(-) | LmjF.25:592410..594527(-) | LmjF.25 | Leishmania major strain Friedlin | 29 | OG6_163536 | 0 | 705 | 2118 | 80248 | 9.71 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53);3.4.22.5 (Transferred entry: 3.4.22.33) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.25.1480ORcalpain family cysteine protease-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.25.1480 OR calpain family cysteine protease-like protein AND Leishmania major strain Friedlin |
|
LmjF.25.1790 | LmjF.25.1790:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 903 | LmjF.25.1790 | hypothetical protein, conserved | hypothetical protein, conserved | | Q4Q9R0 | 25 | LmjF.25:715,520..716,422(-) | LmjF.25:715520..716422(-) | LmjF.25 | Leishmania major strain Friedlin | 98 | OG6_158192 | 0 | 300 | 903 | 34626 | 5.45 | 1 | NN: MNLVRVSLLCACTTLLCLSA, HMM: MNLVRVSLLCACTTLLCLSAL | NN Sum: 3, NN D: .66, HMM Prob: .94 | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.25.1790ORhypothetical protein, conservedANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.25.1790 OR hypothetical protein, conserved AND Leishmania major strain Friedlin |
|
LmjF.25.2320 | LmjF.25.2320:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 438 | LmjF.25.2320 | Microsomal signal peptidase 12 kDa subunit (SPC12), putative | Microsomal signal peptidase 12 kDa subunit (SPC12), putative | | Q95ZB5 | 25 | LmjF.25:864,140..864,577(+) | LmjF.25:864140..864577(+) | LmjF.25 | Leishmania major strain Friedlin | 43 | OG6_147500 | 0 | 145 | 438 | 15806 | 7.86 | 1 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783 | endoplasmic reticulum | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.25.2320ORMicrosomal signal peptidase 12 kDa subunit (SPC12), putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.25.2320 OR Microsomal signal peptidase 12 kDa subunit (SPC12), putative AND Leishmania major strain Friedlin |
|
LmjF.25.2380 | LmjF.25.2380:pseudogenic_transcript | 3 | 1 | 1 | | | forward | protein coding | Yes | 2178 | LmjF.25.2380 | glutathionylspermidine synthase, putative | glutathionylspermidine synthase, putative | | | 25 | LmjF.25:884,961..887,141(+) | LmjF.25:884961..887141(+) | LmjF.25 | Leishmania major strain Friedlin | 0 | N/A (orthology not determined because poor protein quality) | 0 | 725 | 2178 | 80457 | 5.88 | 0 | | | | | | | | | | | | | | | 6.3.1.8 (Glutathionylspermidine synthase) | 4.6.1.1 (Adenylate cyclase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.25.2380ORglutathionylspermidine synthase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.25.2380 OR glutathionylspermidine synthase, putative AND Leishmania major strain Friedlin |
|
LmjF.25.2430 | LmjF.25.2430:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1596 | LmjF.25.2430 | Xaa-Pro aminopeptidase, putative | Xaa-Pro aminopeptidase, putative | | Q4Q9J5 | 25 | LmjF.25:898,219..899,814(+) | LmjF.25:898219..899814(+) | LmjF.25 | Leishmania major strain Friedlin | 60 | OG6_100896 | 1 | 531 | 1596 | 59302 | 6.24 | 0 | | | | | | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.25.2430ORXaa-Pro aminopeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.25.2430 OR Xaa-Pro aminopeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.26.0300 | LmjF.26.0300:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2664 | LmjF.26.0300 | aminopeptidase-like protein | aminopeptidase-like protein | | Q4Q9G1 | 26 | LmjF.26:76,073..78,736(-) | LmjF.26:76073..78736(-) | LmjF.26 | Leishmania major strain Friedlin | 59 | OG6_100948 | 0 | 887 | 2664 | 98092 | 5.64 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.11.- (Aminopeptidases.) | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.26.0300ORaminopeptidase-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.26.0300 OR aminopeptidase-like protein AND Leishmania major strain Friedlin |
|
LmjF.26.1570 | LmjF.26.1570:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2058 | LmjF.26.1570 | thimet oligopeptidase, putative | thimet oligopeptidase, putative | | Q4Q937 | 26 | LmjF.26:577,306..579,363(+) | LmjF.26:577306..579363(+) | LmjF.26 | Leishmania major strain Friedlin | 117 | OG6_100561 | 3 | 685 | 2058 | 77196 | 5.64 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.26.1570ORthimet oligopeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.26.1570 OR thimet oligopeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.26.2070 | LmjF.26.2070:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4056 | LmjF.26.2070 | SUMO1/Ulp2, putative | SUMO1/Ulp2, putative | | Q4Q8Y5 | 26 | LmjF.26:813,481..817,536(+) | LmjF.26:813481..817536(+) | LmjF.26 | Leishmania major strain Friedlin | 51 | OG6_101235 | 0 | 1351 | 4056 | 143101 | 8.18 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005634 | nucleus | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.26.2070ORSUMO1/Ulp2, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.26.2070 OR SUMO1/Ulp2, putative AND Leishmania major strain Friedlin |
|
LmjF.26.2420 | LmjF.26.2420:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1935 | LmjF.26.2420 | hypothetical protein, conserved | hypothetical protein, conserved | | Q4Q8U9 | 26 | LmjF.26:984,728..986,662(+) | LmjF.26:984728..986662(+) | LmjF.26 | Leishmania major strain Friedlin | 52 | OG6_139357 | 0 | 644 | 1935 | 71433 | 7.72 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.26.2420ORhypothetical protein, conservedANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.26.2420 OR hypothetical protein, conserved AND Leishmania major strain Friedlin |
|
LmjF.26.2690 | LmjF.26.2690:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 858 | LmjF.26.2690 | CAAX prenyl protease 2, putative | CAAX prenyl protease 2, putative | | Q4Q8S2 | 26 | LmjF.26:1,085,517..1,086,374(+) | LmjF.26:1085517..1086374(+) | LmjF.26 | Leishmania major strain Friedlin | 53 | OG6_103186 | 0 | 285 | 858 | 31621 | 8.54 | 2 | HMM: MDLLLCAGASAAFIAAF, NN: MDLLLCAGASAAFIAAFYVWPCERRFVFSGLQSLYAAAR | NN Sum: 1, NN D: .31, HMM Prob: .93 | GO:0016020 | membrane | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.26.2690ORCAAX prenyl protease 2, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.26.2690 OR CAAX prenyl protease 2, putative AND Leishmania major strain Friedlin |
|
LmjF.27.0040 | LmjF.27.0040:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1284 | LmjF.27.0040 | metallo- peptidase, Clan M- Family M48 | metallo- peptidase, Clan M- Family M48 | | E9ACY1 | 27 | LmjF.27:12,169..13,452(-) | LmjF.27:12169..13452(-) | LmjF.27 | Leishmania major strain Friedlin | 47 | OG6_101632 | 0 | 427 | 1284 | 49225 | 8.76 | 3 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | GO:0004222 | metalloendopeptidase activity | GO:0071586;GO:0006508 | CAAX-box protein processing;proteolysis | 3.4.24.84 (Ste24 endopeptidase) | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.27.0040ORmetallo- peptidase, Clan M- Family M48ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.27.0040 OR metallo- peptidase, Clan M- Family M48 AND Leishmania major strain Friedlin |
|
LmjF.27.0190 | LmjF.27.0190:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 717 | LmjF.27.0190 | proteasome alpha 7 subunit, putative | proteasome alpha 7 subunit, putative | | E9ACZ6 | 27 | LmjF.27:46,101..46,817(-) | LmjF.27:46101..46817(-) | LmjF.27 | Leishmania major strain Friedlin | 52 | OG6_102011 | 0 | 238 | 717 | 25633 | 6.30 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.27.0190ORproteasome alpha 7 subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.27.0190 OR proteasome alpha 7 subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.27.0460 | LmjF.27.0460:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1878 | LmjF.27.0460 | Vasohibin, putative | Vasohibin, putative | | E9AD23 | 27 | LmjF.27:128,781..130,658(+) | LmjF.27:128781..130658(+) | LmjF.27 | Leishmania major strain Friedlin | 48 | OG6_105471 | 0 | 625 | 1878 | 68291 | 8.77 | 0 | | | GO:0005737 | cytoplasm | | | GO:0045765 | regulation of angiogenesis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.27.0460ORVasohibin, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.27.0460 OR Vasohibin, putative AND Leishmania major strain Friedlin |
|
LmjF.27.0490 | LmjF.27.0490:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 13662 | LmjF.27.0490 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9AD26 | 27 | LmjF.27:144,134..157,795(+) | LmjF.27:144134..157795(+) | LmjF.27 | Leishmania major strain Friedlin | 315 | OG6_115879 | 2 | 4553 | 13662 | 521120 | 4.89 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.27.0490ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.27.0490 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.27.0500 | LmjF.27.0500:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 18495 | LmjF.27.0500 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9AD27 | 27 | LmjF.27:164,885..183,379(+) | LmjF.27:164885..183379(+) | LmjF.27 | Leishmania major strain Friedlin | 315 | OG6_115879 | 2 | 6164 | 18495 | 700251 | 4.92 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.27.0500ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.27.0500 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.27.0510 | LmjF.27.0510:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 16077 | LmjF.27.0510 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9AD28 | 27 | LmjF.27:194,587..210,663(+) | LmjF.27:194587..210663(+) | LmjF.27 | Leishmania major strain Friedlin | 315 | OG6_115879 | 2 | 5358 | 16077 | 600573 | 5.25 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.27.0510ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.27.0510 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.27.1270 | LmjF.27.1270.2:mRNA | 2 | 1 | 2 | | 22 | forward | protein coding | No | 1750 | LmjF.27.1270 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9ADA6 | 27 | LmjF.27:533,887..535,636(+) | LmjF.27:533909..535636(+) | LmjF.27 | Leishmania major strain Friedlin | 56 | OG6_101021 | 0 | 575 | 1728 | 65258 | 7.60 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.27.1270ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.27.1270 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.27.1870 | LmjF.27.1870:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1959 | LmjF.27.1870 | trypanothione synthetase | trypanothione synthetase | | Q711P7 | 27 | LmjF.27:806,164..808,122(-) | LmjF.27:806164..808122(-) | LmjF.27 | Leishmania major strain Friedlin | 53 | OG6_111169 | 0 | 652 | 1959 | 74433 | 5.52 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | 3.5.1.78 (Glutathionylspermidine amidase);6.3.1.9 (Trypanothione synthase) | 3.5.1.78 (Glutathionylspermidine amidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.27.1870ORtrypanothione synthetaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.27.1870 OR trypanothione synthetase AND Leishmania major strain Friedlin |
|
LmjF.27.2630 | LmjF.27.2630:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2454 | LmjF.27.2630 | ATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putative | ATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putative | | E9ACE5 | 27 | LmjF.27:1,119,384..1,121,837(+) | LmjF.27:1119384..1121837(+) | LmjF.27 | Leishmania major strain Friedlin | 140 | OG6_100223 | 2 | 817 | 2454 | 90899 | 6.96 | 0 | NN: MLRRCLAQASTALRCGSTAALAA, HMM: MLRRCLAQASTALRCGSTAALAA | NN Sum: 2, NN D: .42, HMM Prob: .99 | | | GO:0005524 | ATP binding | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.27.2630ORATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.27.2630 OR ATP-dependent Clp protease subunit, heat shock protein 78 (HSP78), putative AND Leishmania major strain Friedlin |
|
LmjF.27.2660 | LmjF.27.2660:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2037 | LmjF.27.2660 | peptidyl dipeptidase, putative | peptidyl dipeptidase, putative | | E9ACE8 | 27 | LmjF.27:1,125,916..1,127,952(+) | LmjF.27:1125916..1127952(+) | LmjF.27 | Leishmania major strain Friedlin | 117 | OG6_100561 | 3 | 678 | 2037 | 76567 | 6.06 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.27.2660ORpeptidyl dipeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.27.2660 OR peptidyl dipeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.28.0110 | LmjF.28.0110:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 618 | LmjF.28.0110 | proteasome beta 3 subunit, putative | proteasome beta 3 subunit, putative | | Q4Q8Q9 | 28 | LmjF.28:31,856..32,473(+) | LmjF.28:31856..32473(+) | LmjF.28 | Leishmania major strain Friedlin | 52 | OG6_101970 | 0 | 205 | 618 | 22462 | 5.09 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.28.0110ORproteasome beta 3 subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.28.0110 OR proteasome beta 3 subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.28.0570 | LmjF.28.0570:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1701 | LmjF.28.0570 | major surface protease gp63, putative | major surface protease gp63, putative | | Q4Q8L3 | 28 | LmjF.28:201,489..203,189(-) | LmjF.28:201489..203189(-) | LmjF.28 | Leishmania major strain Friedlin | 619 | OG6_101754 | 4 | 566 | 1701 | 60724 | 6.55 | 2 | HMM: MCRTLLGIAVAFALVCCVVGPGAAQ, NN: MCRTLLGIAVAFALVCCVVGPGAAQ | NN Sum: 4, NN D: .79, HMM Prob: 1 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | 3.4.24.36 (Leishmanolysin) | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.28.0570ORmajor surface protease gp63, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.28.0570 OR major surface protease gp63, putative AND Leishmania major strain Friedlin |
|
LmjF.28.1950 | LmjF.28.1950:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2283 | LmjF.28.1950 | X-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putative | X-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putative | | Q4Q871 | 28 | LmjF.28:754,856..757,138(-) | LmjF.28:754856..757138(-) | LmjF.28 | Leishmania major strain Friedlin | 53 | OG6_111836 | 0 | 760 | 2283 | 85081 | 6.47 | 0 | | | | | GO:0008239;GO:0016787 | dipeptidyl-peptidase activity;hydrolase activity | | | | | | | | | | 3.1.1.43 (Alpha-amino-acid esterase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.28.1950ORX-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.28.1950 OR X-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putative AND Leishmania major strain Friedlin |
|
LmjF.28.2800 | LmjF.28.2800:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1497 | LmjF.28.2800 | beta-lactamase, putative | beta-lactamase, putative | | Q4Q7Y2 | 28 | LmjF.28:1,065,641..1,067,137(-) | LmjF.28:1065641..1067137(-) | LmjF.28 | Leishmania major strain Friedlin | 50 | OG6_147553 | 0 | 498 | 1497 | 55640 | 8.37 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.28.2800ORbeta-lactamase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.28.2800 OR beta-lactamase, putative AND Leishmania major strain Friedlin |
|
LmjF.29.0020 | LmjF.29.0020:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3138 | LmjF.29.0020 | transcription factor-like protein | transcription factor-like protein | | E9ADK4 | 29 | LmjF.29:4,194..7,331(-) | LmjF.29:4194..7331(-) | LmjF.29 | Leishmania major strain Friedlin | 53 | OG6_102309 | 0 | 1045 | 3138 | 114802 | 4.93 | 0 | HMM: MQPSANHTISASRLSAVLAQWQAAAAR, NN: MQPSANHTISASRLSAVLAQWQAAAAR | NN Sum: 1, NN D: .33, HMM Prob: .87 | | | | | | | GO:0005634 | nucleus | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.29.0020ORtranscription factor-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.29.0020 OR transcription factor-like protein AND Leishmania major strain Friedlin |
|
LmjF.29.0820 | LmjF.29.0820:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1023 | LmjF.29.0820 | CPC cysteine peptidase, Clan CA, family C1, Cathepsin B-like | CPC cysteine peptidase, Clan CA, family C1, Cathepsin B-like | | E9ADT5 | 29 | LmjF.29:305,795..306,817(-) | LmjF.29:305795..306817(-) | LmjF.29 | Leishmania major strain Friedlin | 79 | OG6_101151 | 0 | 340 | 1023 | 37234 | 5.05 | 1 | HMM: MALRAKSALCLVAVFALLLATTVSGLYAK, NN: MALRAKSALCLVAVFALLLATTVSGL | NN Sum: 4, NN D: .88, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.29.0820ORCPC cysteine peptidase, Clan CA, family C1, Cathepsin B-likeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.29.0820 OR CPC cysteine peptidase, Clan CA, family C1, Cathepsin B-like AND Leishmania major strain Friedlin |
|
LmjF.29.0910 | LmjF.29.0910:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1017 | LmjF.29.0910 | signal peptide peptidase, putative | signal peptide peptidase, putative | | E9ADU8 | 29 | LmjF.29:348,320..349,336(+) | LmjF.29:348320..349336(+) | LmjF.29 | Leishmania major strain Friedlin | 49 | OG6_102328 | 0 | 338 | 1017 | 36845 | 5.33 | 8 | HMM: MSQICIALTFLVTCAITAVAVGAL, NN: MSQICIALTFLVTCAITAVAVGA | NN Sum: 4, NN D: .72, HMM Prob: .98 | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.29.0910ORsignal peptide peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.29.0910 OR signal peptide peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.29.1270 | LmjF.29.1270:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2604 | LmjF.29.1270 | Heat shock protein 100 kDa | Heat shock protein 100 kDa | | E9ADY5 | 29 | LmjF.29:509,423..512,026(+) | LmjF.29:509423..512026(+) | LmjF.29 | Leishmania major strain Friedlin | 140 | OG6_100223 | 2 | 867 | 2604 | 96923 | 7.23 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.29.1270ORHeat shock protein 100 kDaANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.29.1270 OR Heat shock protein 100 kDa AND Leishmania major strain Friedlin |
|
LmjF.29.1570 | LmjF.29.1570:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1206 | LmjF.29.1570 | glutamamyl carboxypeptidase, putative | glutamamyl carboxypeptidase, putative | | E9AE16 | 29 | LmjF.29:719,667..720,872(-) | LmjF.29:719667..720872(-) | LmjF.29 | Leishmania major strain Friedlin | 697 | OG6_100626 | 1 | 401 | 1206 | 43837 | 5.27 | 0 | | | GO:0005737 | cytoplasm | GO:0008777;GO:0016787 | acetylornithine deacetylase activity;hydrolase activity | GO:0006526;GO:0008152 | arginine biosynthetic process;metabolic process | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.5.1.16 (Acetylornithine deacetylase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.29.1570ORglutamamyl carboxypeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.29.1570 OR glutamamyl carboxypeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.29.2240 | LmjF.29.2240:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2607 | LmjF.29.2240 | Aminopeptidase M1, putative | Aminopeptidase M1, putative | | E9AE86 | 29 | LmjF.29:987,764..990,370(-) | LmjF.29:987764..990370(-) | LmjF.29 | Leishmania major strain Friedlin | 60 | OG6_137617 | 0 | 868 | 2607 | 96388 | 6.15 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.29.2240ORAminopeptidase M1, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.29.2240 OR Aminopeptidase M1, putative AND Leishmania major strain Friedlin |
|
LmjF.29.2300 | LmjF.29.2300:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2247 | LmjF.29.2300 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9AE92 | 29 | LmjF.29:1,018,994..1,021,240(-) | LmjF.29:1018994..1021240(-) | LmjF.29 | Leishmania major strain Friedlin | 53 | OG6_101380 | 0 | 748 | 2247 | 81507 | 5.64 | 0 | | | | | GO:0004843;GO:0036459;GO:0008270 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | GO:0005654 | nucleoplasm | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.29.2300ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.29.2300 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.29.2360 | LmjF.29.2360:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1362 | LmjF.29.2360 | aspartyl aminopeptidase, putative | aspartyl aminopeptidase, putative | | E9AE98 | 29 | LmjF.29:1,033,812..1,035,173(+) | LmjF.29:1033812..1035173(+) | LmjF.29 | Leishmania major strain Friedlin | 50 | OG6_102047 | 0 | 453 | 1362 | 49672 | 6.60 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737;GO:0031514 | cytoplasm;motile cilium | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.29.2360ORaspartyl aminopeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.29.2360 OR aspartyl aminopeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.29.2770 | LmjF.29.2770:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 615 | LmjF.29.2770 | hypothetical protein, conserved | hypothetical protein, conserved | | E9AED9 | 29 | LmjF.29:1,175,105..1,175,719(+) | LmjF.29:1175105..1175719(+) | LmjF.29 | Leishmania major strain Friedlin | 47 | OG6_158140 | 0 | 204 | 615 | 21910 | 6.79 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.29.2770ORhypothetical protein, conservedANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.29.2770 OR hypothetical protein, conserved AND Leishmania major strain Friedlin |
|
LmjF.30.0050 | LmjF.30.0050:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2289 | LmjF.30.0050 | MATH domain containing protein, putative | MATH domain containing protein, putative | | Q4Q7V4 | 30 | LmjF.30:11,495..13,783(-) | LmjF.30:11495..13783(-) | LmjF.30 | Leishmania major strain Friedlin | 52 | OG6_134892 | 0 | 762 | 2289 | 86883 | 5.67 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.30.0050ORMATH domain containing protein, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.30.0050 OR MATH domain containing protein, putative AND Leishmania major strain Friedlin |
|
LmjF.30.0250 | LmjF.30.0250:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3396 | LmjF.30.0250 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | Q4Q7T4 | 30 | LmjF.30:72,262..75,657(-) | LmjF.30:72262..75657(-) | LmjF.30 | Leishmania major strain Friedlin | 52 | OG6_102772 | 0 | 1131 | 3396 | 126165 | 5.03 | 0 | | | | | GO:0005515 | protein binding | | | | | | | GO:0000289;GO:0010608 | nuclear-transcribed mRNA poly(A) tail shortening;posttranscriptional regulation of gene expression | | 3.1.13.4 (Poly(A)-specific ribonuclease) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.30.0250ORubiquitin hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.30.0250 OR ubiquitin hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.30.0270 | LmjF.30.0270:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1185 | LmjF.30.0270 | AUT2/APG4/ATG4 cysteine peptidase, putative | AUT2/APG4/ATG4 cysteine peptidase, putative | | Q4Q7T2 | 30 | LmjF.30:81,004..82,188(-) | LmjF.30:81004..82188(-) | LmjF.30 | Leishmania major strain Friedlin | 97 | OG6_100501 | 1 | 394 | 1185 | 43891 | 6.27 | 0 | | | | | | | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0000045 | autophagosome assembly | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.30.0270ORAUT2/APG4/ATG4 cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.30.0270 OR AUT2/APG4/ATG4 cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.30.0400 | LmjF.30.0400:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1275 | LmjF.30.0400 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | Q4Q7R9 | 30 | LmjF.30:133,360..134,634(-) | LmjF.30:133360..134634(-) | LmjF.30 | Leishmania major strain Friedlin | 48 | OG6_105308 | 0 | 424 | 1275 | 46319 | 6.11 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.30.0400ORAlpha/beta hydrolase family, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.30.0400 OR Alpha/beta hydrolase family, putative AND Leishmania major strain Friedlin |
|
LmjF.30.0750 | LmjF.30.0750:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 591 | LmjF.30.0750 | 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative | 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative | | Q4Q7N0 | 30 | LmjF.30:239,105..239,695(+) | LmjF.30:239105..239695(+) | LmjF.30 | Leishmania major strain Friedlin | 48 | OG6_101257 | 0 | 196 | 591 | 20476 | 6.51 | 0 | | | | | | | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.30.0750OR4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.30.0750 OR 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative AND Leishmania major strain Friedlin |
|
LmjF.30.1380 | LmjF.30.1380:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 972 | LmjF.30.1380 | amidohydrolase, putative | amidohydrolase, putative | | Q4Q7G6 | 30 | LmjF.30:479,893..480,864(+) | LmjF.30:479893..480864(+) | LmjF.30 | Leishmania major strain Friedlin | 181 | OG6_101553 | 4 | 323 | 972 | 34820 | 5.37 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.30.1380ORamidohydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.30.1380 OR amidohydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.30.2040 | LmjF.30.2040.1:mRNA | 2 | 1 | 2 | | 1101 | forward | protein coding | No | 5529 | LmjF.30.2040 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | Q4Q790 | 30 | LmjF.30:759,591..765,119(+) | LmjF.30:760692..765119(+) | LmjF.30 | Leishmania major strain Friedlin | 52 | OG6_146872 | 0 | 1475 | 4428 | 161848 | 7.32 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930 | axoneme | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.30.2040ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.30.2040 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.31.0100 | LmjF.31.0100:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1095 | LmjF.31.0100 | O-sialoglycoprotein endopeptidase, putative | O-sialoglycoprotein endopeptidase, putative | | Q4Q6Q4 | 31 | LmjF.31:27,077..28,171(-) | LmjF.31:27077..28171(-) | LmjF.31 | Leishmania major strain Friedlin | 55 | OG6_100288 | 0 | 364 | 1095 | 39870 | 7.75 | 0 | | | | | | | | | | | | | | | 3.4.24.57 (O-sialoglycoprotein endopeptidase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.0100ORO-sialoglycoprotein endopeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.0100 OR O-sialoglycoprotein endopeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.31.0140 | LmjF.31.0140:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1374 | LmjF.31.0140 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | Q4Q6Q0 | 31 | LmjF.31:36,206..37,579(-) | LmjF.31:36206..37579(-) | LmjF.31 | Leishmania major strain Friedlin | 58 | OG6_101892 | 0 | 457 | 1374 | 50657 | 6.04 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.0140ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.0140 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.31.0390 | LmjF.31.0390:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2355 | LmjF.31.0390 | Calpain-like protein 2 | Calpain-like protein 2 | | Q4Q6M4 | 31 | LmjF.31:125,122..127,476(-) | LmjF.31:125122..127476(-) | LmjF.31 | Leishmania major strain Friedlin | 53 | OG6_156861 | 0 | 784 | 2355 | 89210 | 4.73 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.0390ORCalpain-like protein 2ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.0390 OR Calpain-like protein 2 AND Leishmania major strain Friedlin |
|
LmjF.31.0400 | LmjF.31.0400:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 4476 | LmjF.31.0400 | calpain-like protein, putative | calpain-like protein, putative | | Q4Q6M3 | 31 | LmjF.31:128,306..132,781(-) | LmjF.31:128306..132781(-) | LmjF.31 | Leishmania major strain Friedlin | 40 | OG6_200267 | 0 | 1491 | 4476 | 161006 | 7.96 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.0400ORcalpain-like protein, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.0400 OR calpain-like protein, putative AND Leishmania major strain Friedlin |
|
LmjF.31.0410 | LmjF.31.0410:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2625 | LmjF.31.0410 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | Q4Q6M2 | 31 | LmjF.31:135,021..137,645(-) | LmjF.31:135021..137645(-) | LmjF.31 | Leishmania major strain Friedlin | 24 | OG6_478567 | 0 | 874 | 2625 | 95559 | 6.76 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.0410ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.0410 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.31.0430 | LmjF.31.0430:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2817 | LmjF.31.0430 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | Q4Q6M0 | 31 | LmjF.31:140,681..143,497(-) | LmjF.31:140681..143497(-) | LmjF.31 | Leishmania major strain Friedlin | 22 | OG6_200268 | 0 | 938 | 2817 | 101653 | 5.26 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.0430ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.0430 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.31.0440 | LmjF.31.0440:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2172 | LmjF.31.0440 | cytoskeleton-associated protein CAP5.5, putative | cytoskeleton-associated protein CAP5.5, putative | | Q4Q6L9 | 31 | LmjF.31:145,479..147,650(-) | LmjF.31:145479..147650(-) | LmjF.31 | Leishmania major strain Friedlin | 57 | OG6_143858 | 0 | 723 | 2172 | 80008 | 4.99 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0036064;GO:0020016;GO:0030863;GO:0020038 | ciliary basal body;ciliary pocket;cortical cytoskeleton;subpellicular network | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.0440ORcytoskeleton-associated protein CAP5.5, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.0440 OR cytoskeleton-associated protein CAP5.5, putative AND Leishmania major strain Friedlin |
|
LmjF.31.0460 | LmjF.31.0460.1:mRNA | 2 | 1 | 2 | | 21 | reverse | protein coding | No | 2145 | LmjF.31.0460 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | Q4Q6L7 | 31 | LmjF.31:157,207..160,642(-) | LmjF.31:157207..159330(-) | LmjF.31 | Leishmania major strain Friedlin | 53 | OG6_104309 | 0 | 707 | 2124 | 79879 | 9.70 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.0460ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.0460 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.31.1130 | LmjF.31.1130:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1218 | LmjF.31.1130 | amidohydrolase, putative | amidohydrolase, putative | | Q4Q6F0 | 31 | LmjF.31:443,635..444,852(-) | LmjF.31:443635..444852(-) | LmjF.31 | Leishmania major strain Friedlin | 181 | OG6_101553 | 4 | 405 | 1218 | 43843 | 5.59 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.1130ORamidohydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.1130 OR amidohydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.31.1140 | LmjF.31.1140:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 936 | LmjF.31.1140 | monoglyceride lipase, putative | monoglyceride lipase, putative | | Q4Q6E9 | 31 | LmjF.31:446,427..447,362(-) | LmjF.31:446427..447362(-) | LmjF.31 | Leishmania major strain Friedlin | 81 | OG6_100231 | 0 | 311 | 936 | 34580 | 6.34 | 0 | | | | | | | | | GO:0005737;GO:0020015 | cytoplasm;glycosome | | | | | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.1140ORmonoglyceride lipase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.1140 OR monoglyceride lipase, putative AND Leishmania major strain Friedlin |
|
LmjF.31.1810 | LmjF.31.1810:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 381 | LmjF.31.1810 | acetylornithine deacetylase-like protein | acetylornithine deacetylase-like protein | | Q4Q681 | 31 | LmjF.31:856,091..856,471(-) | LmjF.31:856091..856471(-) | LmjF.31 | Leishmania major strain Friedlin | 9 | OG6_479041 | 0 | 126 | 381 | 13366 | 5.68 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.1810ORacetylornithine deacetylase-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.1810 OR acetylornithine deacetylase-like protein AND Leishmania major strain Friedlin |
|
LmjF.31.1890 | LmjF.31.1890:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1731 | LmjF.31.1890 | peptidase m20/m25/m40 family-like protein | peptidase m20/m25/m40 family-like protein | | Q4Q673 | 31 | LmjF.31:928,359..930,089(-) | LmjF.31:928359..930089(-) | LmjF.31 | Leishmania major strain Friedlin | 93 | OG6_100503 | 2 | 576 | 1731 | 62036 | 6.32 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.1890ORpeptidase m20/m25/m40 family-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.1890 OR peptidase m20/m25/m40 family-like protein AND Leishmania major strain Friedlin |
|
LmjF.31.2000 | LmjF.31.2000:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1911 | LmjF.31.2000 | GP63-like protein, leishmanolysin-like protein | GP63-like protein, leishmanolysin-like protein | | Q4Q662 | 31 | LmjF.31:979,311..981,221(-) | LmjF.31:979311..981221(-) | LmjF.31 | Leishmania major strain Friedlin | 44 | OG6_101184 | 0 | 636 | 1911 | 67409 | 7.54 | 2 | NN: MSHVPAVLWRMELWLCALFIYAAFTTAA, HMM: MSHVPAVLWRMELWLCALFIYAAFTTAAA | NN Sum: 4, NN D: .8, HMM Prob: 1 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | 3.4.24.36 (Leishmanolysin) | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.2000ORGP63-like protein, leishmanolysin-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.2000 OR GP63-like protein, leishmanolysin-like protein AND Leishmania major strain Friedlin |
|
LmjF.31.2020 | LmjF.31.2020:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1731 | LmjF.31.2020 | succinyl-diaminopimelate desuccinylase-like protein | succinyl-diaminopimelate desuccinylase-like protein | | Q4Q660 | 31 | LmjF.31:989,146..990,876(-) | LmjF.31:989146..990876(-) | LmjF.31 | Leishmania major strain Friedlin | 93 | OG6_100503 | 2 | 576 | 1731 | 62058 | 6.46 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.2020ORsuccinyl-diaminopimelate desuccinylase-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.2020 OR succinyl-diaminopimelate desuccinylase-like protein AND Leishmania major strain Friedlin |
|
LmjF.31.2260 | LmjF.31.2260:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1866 | LmjF.31.2260 | aminopeptidase, putative | aminopeptidase, putative | | Q4Q635 | 31 | LmjF.31:1,122,645..1,124,510(-) | LmjF.31:1122645..1124510(-) | LmjF.31 | Leishmania major strain Friedlin | 55 | OG6_158281 | 0 | 621 | 1866 | 66348 | 7.23 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.2260ORaminopeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.2260 OR aminopeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.31.2970 | LmjF.31.2970:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 6507 | LmjF.31.2970 | acetyl-CoA carboxylase | acetyl-CoA carboxylase | | Q4Q5W1 | 31 | LmjF.31:1,395,180..1,401,686(-) | LmjF.31:1395180..1401686(-) | LmjF.31 | Leishmania major strain Friedlin | 74 | OG6_101052 | 0 | 2168 | 6507 | 241133 | 6.33 | 0 | | | | | GO:0005524;GO:0003989;GO:0016874;GO:0046872 | ATP binding;acetyl-CoA carboxylase activity;ligase activity;metal ion binding | GO:0006633 | fatty acid biosynthetic process | GO:0009343;GO:0005737;GO:0020015 | biotin carboxylase complex;cytoplasm;glycosome | GO:0005524;GO:0003989;GO:0004075 | ATP binding;acetyl-CoA carboxylase activity;biotin carboxylase activity | GO:0030497;GO:0009372 | fatty acid elongation;quorum sensing | 6.4.1.2 (Acetyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.2970ORacetyl-CoA carboxylaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.2970 OR acetyl-CoA carboxylase AND Leishmania major strain Friedlin |
|
LmjF.31.3090 | LmjF.31.3090:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3243 | LmjF.31.3090 | metallo-peptidase, Clan ME, Family M16 | metallo-peptidase, Clan ME, Family M16 | | Q4Q5U8 | 31 | LmjF.31:1,446,708..1,449,950(-) | LmjF.31:1446708..1449950(-) | LmjF.31 | Leishmania major strain Friedlin | 59 | OG6_100422 | 0 | 1080 | 3243 | 118660 | 4.88 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.31.3090ORmetallo-peptidase, Clan ME, Family M16ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.31.3090 OR metallo-peptidase, Clan ME, Family M16 AND Leishmania major strain Friedlin |
|
LmjF.32.0390 | LmjF.32.0390:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1080 | LmjF.32.0390 | 19S proteasome non-atpase subunit 8 | 19S proteasome non-atpase subunit 8 | | Q4Q5P6 | 32 | LmjF.32:140,620..141,699(-) | LmjF.32:140620..141699(-) | LmjF.32 | Leishmania major strain Friedlin | 52 | OG6_102054 | 0 | 359 | 1080 | 40096 | 5.47 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005838 | proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.32.0390OR19S proteasome non-atpase subunit 8ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.32.0390 OR 19S proteasome non-atpase subunit 8 AND Leishmania major strain Friedlin |
|
LmjF.32.0970 | LmjF.32.0970:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 5685 | LmjF.32.0970 | hypothetical protein, conserved | hypothetical protein, conserved | | Q4Q5I5 | 32 | LmjF.32:365,843..371,527(+) | LmjF.32:365843..371527(+) | LmjF.32 | Leishmania major strain Friedlin | 52 | OG6_147050 | 0 | 1894 | 5685 | 199680 | 6.99 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.32.0970ORhypothetical protein, conservedANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.32.0970 OR hypothetical protein, conserved AND Leishmania major strain Friedlin |
|
LmjF.32.1250 | LmjF.32.1250:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1602 | LmjF.32.1250 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | Q4Q5F7 | 32 | LmjF.32:483,463..485,064(+) | LmjF.32:483463..485064(+) | LmjF.32 | Leishmania major strain Friedlin | 47 | OG6_103260 | 0 | 533 | 1602 | 58398 | 9.11 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737 | cytoplasm | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.32.1250ORubiquitin hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.32.1250 OR ubiquitin hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.32.1310 | LmjF.32.1310:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1149 | LmjF.32.1310 | WLM domain containing protein, putative | WLM domain containing protein, putative | | Q4Q5F1 | 32 | LmjF.32:509,733..510,881(+) | LmjF.32:509733..510881(+) | LmjF.32 | Leishmania major strain Friedlin | 26 | OG6_198984 | 0 | 382 | 1149 | 41191 | 7.16 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.32.1310ORWLM domain containing protein, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.32.1310 OR WLM domain containing protein, putative AND Leishmania major strain Friedlin |
|
LmjF.32.1330 | LmjF.32.1330:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1890 | LmjF.32.1330 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | Q4Q5E9 | 32 | LmjF.32:514,411..516,300(+) | LmjF.32:514411..516300(+) | LmjF.32 | Leishmania major strain Friedlin | 51 | OG6_146568 | 0 | 629 | 1890 | 69417 | 8.85 | 3 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.32.1330ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.32.1330 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania major strain Friedlin |
|
LmjF.32.1500 | LmjF.32.1500:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2157 | LmjF.32.1500 | Metalloprotease M41 FtsH, putative | Metalloprotease M41 FtsH, putative | | Q4Q5D1 | 32 | LmjF.32:590,607..592,763(-) | LmjF.32:590607..592763(-) | LmjF.32 | Leishmania major strain Friedlin | 49 | OG6_134869 | 0 | 718 | 2157 | 78080 | 8.56 | 1 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.32.1500ORMetalloprotease M41 FtsH, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.32.1500 OR Metalloprotease M41 FtsH, putative AND Leishmania major strain Friedlin |
|
LmjF.32.2910 | LmjF.32.2910:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 4026 | LmjF.32.2910 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | Q9U1E5 | 32 | LmjF.32:1,147,605..1,151,630(-) | LmjF.32:1147605..1151630(-) | LmjF.32 | Leishmania major strain Friedlin | 48 | OG6_146381 | 0 | 1341 | 4026 | 148193 | 5.07 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737 | cytoplasm | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.32.2910ORubiquitin hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.32.2910 OR ubiquitin hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.32.3680 | LmjF.32.3680:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1116 | LmjF.32.3680 | 3-hydroxyisobutyryl-coenzyme A hydrolase, putative | 3-hydroxyisobutyryl-coenzyme A hydrolase, putative | | Q4Q4Q4 | 32 | LmjF.32:1,499,257..1,500,372(+) | LmjF.32:1499257..1500372(+) | LmjF.32 | Leishmania major strain Friedlin | 65 | OG6_102025 | 0 | 371 | 1116 | 40100 | 6.12 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | GO:0097014;GO:0005737;GO:0005739;GO:0031981 | ciliary plasm;cytoplasm;mitochondrion;nuclear lumen | | | | | 4.2.1.17 (Enoyl-CoA hydratase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.32.3680OR3-hydroxyisobutyryl-coenzyme A hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.32.3680 OR 3-hydroxyisobutyryl-coenzyme A hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.32.3890 | LmjF.32.3890:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1167 | LmjF.32.3890 | AUT2/APG4/ATG4 cysteine peptidase, putative | AUT2/APG4/ATG4 cysteine peptidase, putative | | Q4Q4N3 | 32 | LmjF.32:1,555,373..1,556,539(+) | LmjF.32:1555373..1556539(+) | LmjF.32 | Leishmania major strain Friedlin | 97 | OG6_100501 | 1 | 388 | 1167 | 42565 | 8.26 | 0 | | | | | | | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006914;GO:0016485 | autophagy;protein processing | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.32.3890ORAUT2/APG4/ATG4 cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.32.3890 OR AUT2/APG4/ATG4 cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.33.0200 | LmjF.33.0200:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 5037 | LmjF.33.0200 | metallo-peptidase, Clan MC, Family M14, putative | metallo-peptidase, Clan MC, Family M14, putative | | Q4Q4K3 | 33 | LmjF.33:49,259..54,295(-) | LmjF.33:49259..54295(-) | LmjF.33 | Leishmania major strain Friedlin | 50 | OG6_101273 | 0 | 1678 | 5037 | 182261 | 8.35 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.17.10 (Carboxypeptidase E) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.0200ORmetallo-peptidase, Clan MC, Family M14, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.0200 OR metallo-peptidase, Clan MC, Family M14, putative AND Leishmania major strain Friedlin |
|
LmjF.33.0400 | LmjF.33.0400:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1221 | LmjF.33.0400 | serine peptidase, Clan SC, Family S9D | serine peptidase, Clan SC, Family S9D | | Q4Q4J7 | 33 | LmjF.33:184,306..185,526(-) | LmjF.33:184306..185526(-) | LmjF.33 | Leishmania major strain Friedlin | 86 | OG6_100915 | 1 | 406 | 1221 | 44662 | 7.73 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.0400ORserine peptidase, Clan SC, Family S9DANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.0400 OR serine peptidase, Clan SC, Family S9D AND Leishmania major strain Friedlin |
|
LmjF.33.1610 | LmjF.33.1610:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1419 | LmjF.33.1610 | cytosolic nonspecific dipeptidase, putative | cytosolic nonspecific dipeptidase, putative | | Q4Q426 | 33 | LmjF.33:759,974..761,392(+) | LmjF.33:759974..761392(+) | LmjF.33 | Leishmania major strain Friedlin | 93 | OG6_100503 | 2 | 472 | 1419 | 51571 | 5.45 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0005737 | cytoplasm | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.1610ORcytosolic nonspecific dipeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.1610 OR cytosolic nonspecific dipeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.33.1800 | LmjF.33.1800:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 648 | LmjF.33.1800 | Der1-like family, putative | Der1-like family, putative | | Q4Q408 | 33 | LmjF.33:818,090..818,737(+) | LmjF.33:818090..818737(+) | LmjF.33 | Leishmania major strain Friedlin | 95 | OG6_101672 | 1 | 215 | 648 | 24825 | 7.96 | 4 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.1800ORDer1-like family, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.1800 OR Der1-like family, putative AND Leishmania major strain Friedlin |
|
LmjF.33.2010 | LmjF.33.2010:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4140 | LmjF.33.2010 | calpain protease-like protein | calpain protease-like protein | | Q4Q3Y6 | 33 | LmjF.33:894,402..898,541(+) | LmjF.33:894402..898541(+) | LmjF.33 | Leishmania major strain Friedlin | 52 | OG6_103851 | 0 | 1379 | 4140 | 150669 | 8.24 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53);3.4.22.5 (Transferred entry: 3.4.22.33) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.2010ORcalpain protease-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.2010 OR calpain protease-like protein AND Leishmania major strain Friedlin |
|
LmjF.33.2260 | LmjF.33.2260:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4299 | LmjF.33.2260 | glycosyl hydrolase-like protein | glycosyl hydrolase-like protein | | Q4Q3W1 | 33 | LmjF.33:1,017,586..1,021,884(+) | LmjF.33:1017586..1021884(+) | LmjF.33 | Leishmania major strain Friedlin | 52 | OG6_104188 | 0 | 1432 | 4299 | 154505 | 6.70 | 0 | | | GO:0005737 | cytoplasm | GO:0033925 | mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity | | | | | | | | | | 3.2.1.96 (Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.2260ORglycosyl hydrolase-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.2260 OR glycosyl hydrolase-like protein AND Leishmania major strain Friedlin |
|
LmjF.33.2540 | LmjF.33.2540:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1500 | LmjF.33.2540 | metallo-peptidase, Clan MA(E) Family M32 | metallo-peptidase, Clan MA(E) Family M32 | | Q4Q3T3 | 33 | LmjF.33:1,138,885..1,140,384(+) | LmjF.33:1138885..1140384(+) | LmjF.33 | Leishmania major strain Friedlin | 152 | OG6_105939 | 3 | 499 | 1500 | 57049 | 5.63 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0004181 | metallocarboxypeptidase activity | GO:0006518;GO:0006508 | peptide metabolic process;proteolysis | 3.4.17.19 (Carboxypeptidase Taq) | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.2540ORmetallo-peptidase, Clan MA(E) Family M32ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.2540 OR metallo-peptidase, Clan MA(E) Family M32 AND Leishmania major strain Friedlin |
|
LmjF.33.2570 | LmjF.33.2570:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1587 | LmjF.33.2570 | metallo-peptidase, Clan MF, Family M17 | metallo-peptidase, Clan MF, Family M17 | | Q4Q3T0 | 33 | LmjF.33:1,157,508..1,159,094(+) | LmjF.33:1157508..1159094(+) | LmjF.33 | Leishmania major strain Friedlin | 51 | OG6_105603 | 0 | 528 | 1587 | 55756 | 7.09 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005654;GO:0005634 | nucleoplasm;nucleus | | | | | 3.4.11.- (Aminopeptidases.) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.2570ORmetallo-peptidase, Clan MF, Family M17ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.2570 OR metallo-peptidase, Clan MF, Family M17 AND Leishmania major strain Friedlin |
|
LmjF.33.2610 | LmjF.33.2610:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1452 | LmjF.33.2610 | Mitochondrial-processing peptidase subunit alpha | Mitochondrial-processing peptidase subunit alpha | | Q4Q3S5 | 33 | LmjF.33:1,172,034..1,173,485(+) | LmjF.33:1172034..1173485(+) | LmjF.33 | Leishmania major strain Friedlin | 50 | OG6_102381 | 0 | 483 | 1452 | 53112 | 7.03 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005737;GO:0017087 | cytoplasm;mitochondrial processing peptidase complex | GO:0004222 | metalloendopeptidase activity | GO:0030150 | protein import into mitochondrial matrix | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.2610ORMitochondrial-processing peptidase subunit alphaANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.2610 OR Mitochondrial-processing peptidase subunit alpha AND Leishmania major strain Friedlin |
|
LmjF.33.2830 | LmjF.33.2830:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1161 | LmjF.33.2830 | cysteine peptidase, Clan CA, family C51, putative | cysteine peptidase, Clan CA, family C51, putative | | Q4Q3Q2 | 33 | LmjF.33:1,281,794..1,282,954(+) | LmjF.33:1281794..1282954(+) | LmjF.33 | Leishmania major strain Friedlin | 102 | OG6_115782 | 1 | 386 | 1161 | 42783 | 6.41 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.2830ORcysteine peptidase, Clan CA, family C51, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.2830 OR cysteine peptidase, Clan CA, family C51, putative AND Leishmania major strain Friedlin |
|
LmjF.33.2850 | LmjF.33.2850:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1215 | LmjF.33.2850 | cysteine peptidase, Clan CA, family C51, putative | cysteine peptidase, Clan CA, family C51, putative | | Q4Q3Q0 | 33 | LmjF.33:1,293,125..1,294,339(+) | LmjF.33:1293125..1294339(+) | LmjF.33 | Leishmania major strain Friedlin | 102 | OG6_115782 | 1 | 404 | 1215 | 44355 | 7.14 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.2850ORcysteine peptidase, Clan CA, family C51, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.2850 OR cysteine peptidase, Clan CA, family C51, putative AND Leishmania major strain Friedlin |
|
LmjF.33.2860 | LmjF.33.2860:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1458 | LmjF.33.2860 | hypothetical protein, conserved | hypothetical protein, conserved | | Q4Q3P9 | 33 | LmjF.33:1,294,755..1,296,212(+) | LmjF.33:1294755..1296212(+) | LmjF.33 | Leishmania major strain Friedlin | 44 | OG6_173752 | 0 | 485 | 1458 | 53286 | 9.83 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.2860ORhypothetical protein, conservedANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.2860 OR hypothetical protein, conserved AND Leishmania major strain Friedlin |
|
LmjF.33.3130 | LmjF.33.3130:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 918 | LmjF.33.3130 | Trypsin-like peptidase domain containing protein, putative | Trypsin-like peptidase domain containing protein, putative | | Q4Q3M3 | 33 | LmjF.33:1,537,886..1,538,803(+) | LmjF.33:1537886..1538803(+) | LmjF.33 | Leishmania major strain Friedlin | 53 | OG6_137919 | 0 | 305 | 918 | 32659 | 7.01 | 0 | NN: MAEGAAAAAGASALAAASQRRGCCFPILSFLHVPGKMTK, HMM: MAEGAAAAAGASALAAASQRRGC | NN Sum: 0, NN D: .23, HMM Prob: .96 | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.33.3130ORTrypsin-like peptidase domain containing protein, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.33.3130 OR Trypsin-like peptidase domain containing protein, putative AND Leishmania major strain Friedlin |
|
LmjF.34.0280 | LmjF.34.0280:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4851 | LmjF.34.0280 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | Q4Q3I0 | 34 | LmjF.34:97,117..101,967(+) | LmjF.34:97117..101967(+) | LmjF.34 | Leishmania major strain Friedlin | 26 | OG6_200421 | 0 | 1616 | 4851 | 179040 | 8.07 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.0280ORcalpain-like cysteine peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.0280 OR calpain-like cysteine peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.34.0650 | LmjF.34.0650:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 930 | LmjF.34.0650 | proteasome regulatory non-ATPase subunit 11, putative | proteasome regulatory non-ATPase subunit 11, putative | | Q4Q3E2 | 34 | LmjF.34:283,548..284,477(+) | LmjF.34:283548..284477(+) | LmjF.34 | Leishmania major strain Friedlin | 58 | OG6_101835 | 0 | 309 | 930 | 34709 | 7.04 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737;GO:0005838 | cytoplasm;proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.0650ORproteasome regulatory non-ATPase subunit 11, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.0650 OR proteasome regulatory non-ATPase subunit 11, putative AND Leishmania major strain Friedlin |
|
LmjF.34.1060 | LmjF.34.1060:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2370 | LmjF.34.1060 | mitochondrial ATP-dependent zinc metallopeptidase, putative | mitochondrial ATP-dependent zinc metallopeptidase, putative | | Q4Q399 | 34 | LmjF.34:467,387..469,756(+) | LmjF.34:467387..469756(+) | LmjF.34 | Leishmania major strain Friedlin | 52 | OG6_100384 | 0 | 789 | 2370 | 85842 | 8.04 | 0 | NN: MLYRRALVLSRRSLAA, HMM: MLYRRALVLSRRSLAAYTLPACNTSVRFCASS | NN Sum: 3, NN D: .6, HMM Prob: .77 | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.1060ORmitochondrial ATP-dependent zinc metallopeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.1060 OR mitochondrial ATP-dependent zinc metallopeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.34.2000 | LmjF.34.2000.1:mRNA | 2 | 1 | 2 | | 682 | reverse | protein coding | No | 1660 | LmjF.34.2000 | pyroglutamyl-peptidase I (C15 family) | pyroglutamyl-peptidase I (C15 family) | | Q4Q301 | 34 | LmjF.34:876,059..877,718(-) | LmjF.34:876059..877036(-) | LmjF.34 | Leishmania major strain Friedlin | 47 | OG6_101530 | 0 | 325 | 978 | 35412 | 6.50 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0016920 | pyroglutamyl-peptidase activity | | | | 3.4.19.3 (Pyroglutamyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.2000ORpyroglutamyl-peptidase I (C15 family)ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.2000 OR pyroglutamyl-peptidase I (C15 family) AND Leishmania major strain Friedlin |
|
LmjF.34.2810 | LmjF.34.2810:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2637 | LmjF.34.2810 | Carboxypeptidase-like protein | Carboxypeptidase-like protein | | Q4Q2R3 | 34 | LmjF.34:1,289,788..1,292,424(+) | LmjF.34:1289788..1292424(+) | LmjF.34 | Leishmania major strain Friedlin | 53 | OG6_105780 | 0 | 878 | 2637 | 95025 | 9.27 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0043531;GO:0005524;GO:0004181;GO:0008270 | ADP binding;ATP binding;metallocarboxypeptidase activity;zinc ion binding | | | 3.4.17.- (Metallocarboxypeptidases.) | 3.4.17.- (Metallocarboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.2810ORCarboxypeptidase-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.2810 OR Carboxypeptidase-like protein AND Leishmania major strain Friedlin |
|
LmjF.34.4000 | LmjF.34.4000:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1521 | LmjF.34.4000 | Peptidase family C78, putative | Peptidase family C78, putative | | Q4Q2E1 | 34 | LmjF.34:1,715,353..1,716,873(+) | LmjF.34:1715353..1716873(+) | LmjF.34 | Leishmania major strain Friedlin | 52 | OG6_102601 | 0 | 506 | 1521 | 56253 | 6.55 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.4000ORPeptidase family C78, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.4000 OR Peptidase family C78, putative AND Leishmania major strain Friedlin |
|
LmjF.34.4060 | LmjF.34.4060:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2721 | LmjF.34.4060 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | Q4Q2D5 | 34 | LmjF.34:1,728,410..1,731,130(+) | LmjF.34:1728410..1731130(+) | LmjF.34 | Leishmania major strain Friedlin | 45 | OG6_173868 | 0 | 906 | 2721 | 102562 | 5.19 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.4060ORubiquitin hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.4060 OR ubiquitin hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.34.4340 | LmjF.34.4340:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 663 | LmjF.34.4340 | 20s proteasome beta 7 subunit, (putative) | 20s proteasome beta 7 subunit, (putative) | | Q4Q289 | 34 | LmjF.34:1,814,240..1,814,902(+) | LmjF.34:1814240..1814902(+) | LmjF.34 | Leishmania major strain Friedlin | 56 | OG6_101718 | 6 | 220 | 663 | 24693 | 4.79 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981;GO:0019774 | ciliary plasm;cytoplasm;nuclear lumen;proteasome core complex, beta-subunit complex | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.4340OR20s proteasome beta 7 subunit, (putative)ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.4340 OR 20s proteasome beta 7 subunit, (putative) AND Leishmania major strain Friedlin |
|
LmjF.34.4370 | LmjF.34.4370:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 663 | LmjF.34.4370 | 20s proteasome beta 7 subunit, (putative) | 20s proteasome beta 7 subunit, (putative) | | Q4Q289 | 34 | LmjF.34:1,817,781..1,818,443(+) | LmjF.34:1817781..1818443(+) | LmjF.34 | Leishmania major strain Friedlin | 56 | OG6_101718 | 6 | 220 | 663 | 24693 | 4.79 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981;GO:0019774 | ciliary plasm;cytoplasm;nuclear lumen;proteasome core complex, beta-subunit complex | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.4370OR20s proteasome beta 7 subunit, (putative)ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.4370 OR 20s proteasome beta 7 subunit, (putative) AND Leishmania major strain Friedlin |
|
LmjF.34.4400 | LmjF.34.4400:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 663 | LmjF.34.4400 | 20s proteasome beta 7 subunit, (putative) | 20s proteasome beta 7 subunit, (putative) | | Q4Q289 | 34 | LmjF.34:1,821,322..1,821,984(+) | LmjF.34:1821322..1821984(+) | LmjF.34 | Leishmania major strain Friedlin | 56 | OG6_101718 | 6 | 220 | 663 | 24693 | 4.79 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981;GO:0019774 | ciliary plasm;cytoplasm;nuclear lumen;proteasome core complex, beta-subunit complex | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.4400OR20s proteasome beta 7 subunit, (putative)ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.4400 OR 20s proteasome beta 7 subunit, (putative) AND Leishmania major strain Friedlin |
|
LmjF.34.4430 | LmjF.34.4430:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 663 | LmjF.34.4430 | 20s proteasome beta 7 subunit, (putative) | 20s proteasome beta 7 subunit, (putative) | | Q4Q289 | 34 | LmjF.34:1,824,863..1,825,525(+) | LmjF.34:1824863..1825525(+) | LmjF.34 | Leishmania major strain Friedlin | 56 | OG6_101718 | 6 | 220 | 663 | 24693 | 4.79 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981;GO:0019774 | ciliary plasm;cytoplasm;nuclear lumen;proteasome core complex, beta-subunit complex | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.4430OR20s proteasome beta 7 subunit, (putative)ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.4430 OR 20s proteasome beta 7 subunit, (putative) AND Leishmania major strain Friedlin |
|
LmjF.34.4460 | LmjF.34.4460:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 663 | LmjF.34.4460 | 20s proteasome beta 7 subunit, (putative) | 20s proteasome beta 7 subunit, (putative) | | Q4Q289 | 34 | LmjF.34:1,828,404..1,829,066(+) | LmjF.34:1828404..1829066(+) | LmjF.34 | Leishmania major strain Friedlin | 56 | OG6_101718 | 6 | 220 | 663 | 24693 | 4.79 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981;GO:0019774 | ciliary plasm;cytoplasm;nuclear lumen;proteasome core complex, beta-subunit complex | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.4460OR20s proteasome beta 7 subunit, (putative)ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.4460 OR 20s proteasome beta 7 subunit, (putative) AND Leishmania major strain Friedlin |
|
LmjF.34.4490 | LmjF.34.4490:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 663 | LmjF.34.4490 | 20s proteasome beta 7 subunit, (putative) | 20s proteasome beta 7 subunit, (putative) | | Q4Q289 | 34 | LmjF.34:1,831,945..1,832,607(+) | LmjF.34:1831945..1832607(+) | LmjF.34 | Leishmania major strain Friedlin | 56 | OG6_101718 | 6 | 220 | 663 | 24693 | 4.79 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981;GO:0019774 | ciliary plasm;cytoplasm;nuclear lumen;proteasome core complex, beta-subunit complex | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.4490OR20s proteasome beta 7 subunit, (putative)ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.4490 OR 20s proteasome beta 7 subunit, (putative) AND Leishmania major strain Friedlin |
|
LmjF.34.4520 | LmjF.34.4520:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 663 | LmjF.34.4520 | proteasome beta 7 subunit, putative | proteasome beta 7 subunit, putative | | Q4Q289 | 34 | LmjF.34:1,835,485..1,836,147(+) | LmjF.34:1835485..1836147(+) | LmjF.34 | Leishmania major strain Friedlin | 56 | OG6_101718 | 6 | 220 | 663 | 24693 | 4.79 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981;GO:0019774 | ciliary plasm;cytoplasm;nuclear lumen;proteasome core complex, beta-subunit complex | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.34.4520ORproteasome beta 7 subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.34.4520 OR proteasome beta 7 subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.35.1380 | LmjF.35.1380:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1473 | LmjF.35.1380 | mitochondrial processing peptidase, beta subunit, putative | mitochondrial processing peptidase, beta subunit, putative | | E9AEW1 | 35 | LmjF.35:596,163..597,635(+) | LmjF.35:596163..597635(+) | LmjF.35 | Leishmania major strain Friedlin | 53 | OG6_137602 | 0 | 490 | 1473 | 54536 | 6.83 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005737;GO:0005739 | cytoplasm;mitochondrion | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.1380ORmitochondrial processing peptidase, beta subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.1380 OR mitochondrial processing peptidase, beta subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.35.1390 | LmjF.35.1390:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2043 | LmjF.35.1390 | Zn-finger in Ran binding protein and others/OTU-like cysteine protease, putative | Zn-finger in Ran binding protein and others/OTU-like cysteine protease, putative | | E9AEW2 | 35 | LmjF.35:600,998..603,040(+) | LmjF.35:600998..603040(+) | LmjF.35 | Leishmania major strain Friedlin | 50 | OG6_124705 | 0 | 680 | 2043 | 74334 | 8.23 | 0 | | | | | | | | | GO:0051286 | cell tip | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.1390ORZn-finger in Ran binding protein and others/OTU-like cysteine protease, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.1390 OR Zn-finger in Ran binding protein and others/OTU-like cysteine protease, putative AND Leishmania major strain Friedlin |
|
LmjF.35.1580 | LmjF.35.1580:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1308 | LmjF.35.1580 | metacaspase | metacaspase | | E9AEY0 | 35 | LmjF.35:681,364..682,671(-) | LmjF.35:681364..682671(-) | LmjF.35 | Leishmania major strain Friedlin | 158 | OG6_101407 | 0 | 435 | 1308 | 47241 | 8.41 | 1 | NN: MADLFDIWGIGAVASLIPMLANGL, HMM: MADLFDIWGIGAVASLIPMLANGL | NN Sum: 4, NN D: .57, HMM Prob: .32 | | | | | | | GO:0051286;GO:0097014;GO:0005737;GO:0005829;GO:0005759;GO:0031981 | cell tip;ciliary plasm;cytoplasm;cytosol;mitochondrial matrix;nuclear lumen | GO:0004197 | cysteine-type endopeptidase activity | GO:0070301;GO:0008631;GO:0016540;GO:0006979 | cellular response to hydrogen peroxide;intrinsic apoptotic signaling pathway in response to oxidative stress;protein autoprocessing;response to oxidative stress | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.1580ORmetacaspaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.1580 OR metacaspase AND Leishmania major strain Friedlin |
|
LmjF.35.1740 | LmjF.35.1740:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3495 | LmjF.35.1740 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9AEZ5 | 35 | LmjF.35:730,400..733,894(-) | LmjF.35:730400..733894(-) | LmjF.35 | Leishmania major strain Friedlin | 52 | OG6_101317 | 0 | 1164 | 3495 | 133005 | 6.84 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.1740ORubiquitin hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.1740 OR ubiquitin hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.35.1980 | LmjF.35.1980:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1770 | LmjF.35.1980 | hypothetical protein, conserved | hypothetical protein, conserved | | E9AF20 | 35 | LmjF.35:796,427..798,196(+) | LmjF.35:796427..798196(+) | LmjF.35 | Leishmania major strain Friedlin | 54 | OG6_124708 | 0 | 589 | 1770 | 67417 | 6.71 | 0 | | | | | | | | | GO:0030964;GO:0005739 | NADH dehydrogenase complex;mitochondrion | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.1980ORhypothetical protein, conservedANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.1980 OR hypothetical protein, conserved AND Leishmania major strain Friedlin |
|
LmjF.35.2350 | LmjF.35.2350:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1455 | LmjF.35.2350 | aminopeptidase P, putative | aminopeptidase P, putative | | E9AF59 | 35 | LmjF.35:963,545..964,999(+) | LmjF.35:963545..964999(+) | LmjF.35 | Leishmania major strain Friedlin | 54 | OG6_102295 | 0 | 484 | 1455 | 53646 | 5.78 | 0 | | | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | GO:0005737 | cytoplasm | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.2350ORaminopeptidase P, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.2350 OR aminopeptidase P, putative AND Leishmania major strain Friedlin |
|
LmjF.35.2410 | LmjF.35.2410:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2772 | LmjF.35.2410 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9AF65 | 35 | LmjF.35:994,026..996,797(+) | LmjF.35:994026..996797(+) | LmjF.35 | Leishmania major strain Friedlin | 49 | OG6_136424 | 0 | 923 | 2772 | 99097 | 9.63 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.2410ORubiquitin hydrolase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.2410 OR ubiquitin hydrolase, putative AND Leishmania major strain Friedlin |
|
LmjF.35.2800 | LmjF.35.2800:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1203 | LmjF.35.2800 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | E9AFA4 | 35 | LmjF.35:1,150,756..1,151,958(-) | LmjF.35:1150756..1151958(-) | LmjF.35 | Leishmania major strain Friedlin | 50 | OG6_138036 | 0 | 400 | 1203 | 44045 | 8.54 | 4 | NN: MIFGSALVLVVAAINSSAN, HMM: MIFGSALVLVVAAINSSAN | NN Sum: 3, NN D: .54, HMM Prob: .85 | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.2800ORAlpha/beta hydrolase family, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.2800 OR Alpha/beta hydrolase family, putative AND Leishmania major strain Friedlin |
|
LmjF.35.3450 | LmjF.35.3450:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2658 | LmjF.35.3450 | DNA-repair protein, putative | DNA-repair protein, putative | | E9AFG9 | 35 | LmjF.35:1,397,543..1,400,200(-) | LmjF.35:1397543..1400200(-) | LmjF.35 | Leishmania major strain Friedlin | 53 | OG6_144738 | 0 | 885 | 2658 | 97823 | 9.78 | 0 | | | | | GO:0003677 | DNA binding | | | GO:0005737;GO:0031981;GO:0005634 | cytoplasm;nuclear lumen;nucleus | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.3450ORDNA-repair protein, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.3450 OR DNA-repair protein, putative AND Leishmania major strain Friedlin |
|
LmjF.35.3840 | LmjF.35.3840:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 765 | LmjF.35.3840 | proteasome beta 2 subunit, putative | proteasome beta 2 subunit, putative | | E9AFK8 | 35 | LmjF.35:1,527,758..1,528,522(-) | LmjF.35:1527758..1528522(-) | LmjF.35 | Leishmania major strain Friedlin | 47 | OG6_101382 | 0 | 254 | 765 | 27522 | 7.05 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.3840ORproteasome beta 2 subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.3840 OR proteasome beta 2 subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.35.4020 | LmjF.35.4020:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1185 | LmjF.35.4020 | Bem46-like serine peptidase | Bem46-like serine peptidase | | E9AFM7 | 35 | LmjF.35:1,605,602..1,606,786(+) | LmjF.35:1605602..1606786(+) | LmjF.35 | Leishmania major strain Friedlin | 48 | OG6_101827 | 0 | 394 | 1185 | 43023 | 6.71 | 1 | NN: MSFGSFLLSAGLYLVLVAVFVSLFLHIMSY, HMM: MSFGSFLLSAGLYLVLVAVFVSLFLHIMSY | NN Sum: 3, NN D: .65, HMM Prob: .27 | | | | | | | GO:0005783 | endoplasmic reticulum | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.4020ORBem46-like serine peptidaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.4020 OR Bem46-like serine peptidase AND Leishmania major strain Friedlin |
|
LmjF.35.4850 | LmjF.35.4850:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 753 | LmjF.35.4850 | proteasome alpha 1 subunit, putative | proteasome alpha 1 subunit, putative | | E9AFW0 | 35 | LmjF.35:1,892,705..1,893,457(+) | LmjF.35:1892705..1893457(+) | LmjF.35 | Leishmania major strain Friedlin | 48 | OG6_102240 | 0 | 250 | 753 | 27223 | 7.30 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737 | cytoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.35.4850ORproteasome alpha 1 subunit, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.35.4850 OR proteasome alpha 1 subunit, putative AND Leishmania major strain Friedlin |
|
LmjF.36.0200 | LmjF.36.0200:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 678 | LmjF.36.0200 | mitochondrial inner membrane signal peptidase, putative | mitochondrial inner membrane signal peptidase, putative | | Q4Q258 | 36 | LmjF.36:61,341..62,018(-) | LmjF.36:61341..62018(-) | LmjF.36 | Leishmania major strain Friedlin | 47 | OG6_132331 | 0 | 225 | 678 | 25505 | 6.01 | 0 | NN: MPWRQWWSAIRCSQYGDVPFVLLGVFIGWNSDVSCA, HMM: MPWRQWWSAIRCSQYGDVPFVLLGVFIGWNSDVSCA | NN Sum: 2, NN D: .39, HMM Prob: .71 | GO:0016020 | membrane | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | GO:0020023;GO:0005739 | kinetoplast;mitochondrion | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.0200ORmitochondrial inner membrane signal peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.0200 OR mitochondrial inner membrane signal peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.36.0320 | LmjF.36.0320:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 621 | LmjF.36.0320 | proteasome subunit beta type-2, putative | proteasome subunit beta type-2, putative | | Q4Q246 | 36 | LmjF.36:90,862..91,482(-) | LmjF.36:90862..91482(-) | LmjF.36 | Leishmania major strain Friedlin | 51 | OG6_102061 | 0 | 206 | 621 | 23002 | 6.49 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737 | cytoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.0320ORproteasome subunit beta type-2, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.0320 OR proteasome subunit beta type-2, putative AND Leishmania major strain Friedlin |
|
LmjF.36.0780 | LmjF.36.0780:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 3363 | LmjF.36.0780 | Calpain family cysteine protease, putative | Calpain family cysteine protease, putative | | Q4Q1Z8 | 36 | LmjF.36:274,656..278,018(+) | LmjF.36:274656..278018(+) | LmjF.36 | Leishmania major strain Friedlin | 25 | OG6_478742 | 0 | 1120 | 3363 | 121368 | 6.59 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.0780ORCalpain family cysteine protease, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.0780 OR Calpain family cysteine protease, putative AND Leishmania major strain Friedlin |
|
LmjF.36.1380 | LmjF.36.1380:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1653 | LmjF.36.1380 | hypothetical protein, conserved | hypothetical protein, conserved | | Q4Q1T8 | 36 | LmjF.36:503,460..505,112(-) | LmjF.36:503460..505112(-) | LmjF.36 | Leishmania major strain Friedlin | 51 | OG6_146679 | 0 | 550 | 1653 | 60403 | 6.16 | 0 | | | | | GO:0005488 | binding | | | GO:0005739 | mitochondrion | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.1380ORhypothetical protein, conservedANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.1380 OR hypothetical protein, conserved AND Leishmania major strain Friedlin |
|
LmjF.36.1600 | LmjF.36.1600:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 792 | LmjF.36.1600 | proteasome subunit alpha type-1, putative | proteasome subunit alpha type-1, putative | | Q4Q1R5 | 36 | LmjF.36:618,206..618,997(-) | LmjF.36:618206..618997(-) | LmjF.36 | Leishmania major strain Friedlin | 51 | OG6_102143 | 0 | 263 | 792 | 29600 | 4.96 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.1600ORproteasome subunit alpha type-1, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.1600 OR proteasome subunit alpha type-1, putative AND Leishmania major strain Friedlin |
|
LmjF.36.1650 | LmjF.36.1650:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 909 | LmjF.36.1650 | proteasome subunit beta type-5, putative | proteasome subunit beta type-5, putative | | Q4Q1Q9 | 36 | LmjF.36:650,928..651,836(-) | LmjF.36:650928..651836(-) | LmjF.36 | Leishmania major strain Friedlin | 52 | OG6_100897 | 0 | 302 | 909 | 33642 | 5.97 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.1650ORproteasome subunit beta type-5, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.1650 OR proteasome subunit beta type-5, putative AND Leishmania major strain Friedlin |
|
LmjF.36.1690 | LmjF.36.1690:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 927 | LmjF.36.1690 | Peptidase M76 family, putative | Peptidase M76 family, putative | | Q4Q1Q5 | 36 | LmjF.36:662,060..662,986(-) | LmjF.36:662060..662986(-) | LmjF.36 | Leishmania major strain Friedlin | 51 | OG6_102968 | 0 | 308 | 927 | 33549 | 7.11 | 0 | HMM: MGSLSSSSSSSAATGAGAAASQTDAQ, NN: MGSLSSSSSSSAATGAGAAASQTDAQ | NN Sum: 1, NN D: .1, HMM Prob: .95 | | | GO:0004222 | metalloendopeptidase activity | | | GO:0005737 | cytoplasm | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.1690ORPeptidase M76 family, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.1690 OR Peptidase M76 family, putative AND Leishmania major strain Friedlin |
|
LmjF.36.2420 | LmjF.36.2420:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2559 | LmjF.36.2420 | serine peptidase, Clan SC, Family S9B | serine peptidase, Clan SC, Family S9B | | Q4Q1H9 | 36 | LmjF.36:980,511..983,069(+) | LmjF.36:980511..983069(+) | LmjF.36 | Leishmania major strain Friedlin | 57 | OG6_102236 | 0 | 852 | 2559 | 94256 | 5.80 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.14.5 (Dipeptidyl-peptidase IV) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.2420ORserine peptidase, Clan SC, Family S9BANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.2420 OR serine peptidase, Clan SC, Family S9B AND Leishmania major strain Friedlin |
|
LmjF.36.2710 | LmjF.36.2710:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1977 | LmjF.36.2710 | mitochondrial ATP-dependent zinc metallopeptidase, putative | mitochondrial ATP-dependent zinc metallopeptidase, putative | | Q4Q1E9 | 36 | LmjF.36:1,104,954..1,106,930(-) | LmjF.36:1104954..1106930(-) | LmjF.36 | Leishmania major strain Friedlin | 51 | OG6_101196 | 0 | 658 | 1977 | 71924 | 6.62 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005739 | cytoplasm;mitochondrion | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.2710ORmitochondrial ATP-dependent zinc metallopeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.2710 OR mitochondrial ATP-dependent zinc metallopeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.36.2840 | LmjF.36.2840:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 3438 | LmjF.36.2840 | Flagellar Member 2 | Flagellar Member 2 | | Q4Q1D6 | 36 | LmjF.36:1,162,256..1,165,693(-) | LmjF.36:1162256..1165693(-) | LmjF.36 | Leishmania major strain Friedlin | 53 | OG6_146571 | 0 | 1145 | 3438 | 125985 | 5.41 | 0 | | | | | | | | | GO:0005930;GO:0031514 | axoneme;motile cilium | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.2840ORFlagellar Member 2ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.2840 OR Flagellar Member 2 AND Leishmania major strain Friedlin |
|
LmjF.36.3990 | LmjF.36.3990:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 645 | LmjF.36.3990 | ATP-dependent protease subunit HslV, putative | ATP-dependent protease subunit HslV, putative | | Q4Q116 | 36 | LmjF.36:1,526,757..1,527,401(+) | LmjF.36:1526757..1527401(+) | LmjF.36 | Leishmania major strain Friedlin | 51 | OG6_107204 | 0 | 214 | 645 | 23349 | 5.50 | 0 | NN: MFRRLATRSTSLVTGAAVQAR, HMM: MFRRLATRSTSLVTGAAVQAR | NN Sum: 1, NN D: .39, HMM Prob: .9 | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | GO:0009376;GO:0097014;GO:0005737;GO:0042645;GO:0005739;GO:0031981 | HslUV protease complex;ciliary plasm;cytoplasm;mitochondrial nucleoid;mitochondrion;nuclear lumen | GO:0004176 | ATP-dependent peptidase activity | GO:0033955;GO:0006264;GO:0070581 | mitochondrial DNA inheritance;mitochondrial DNA replication;rolling circle DNA replication | 3.4.25.2 (HslU--HslV peptidase) | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.3990ORATP-dependent protease subunit HslV, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.3990 OR ATP-dependent protease subunit HslV, putative AND Leishmania major strain Friedlin |
|
LmjF.36.4030 | LmjF.36.4030:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 4662 | LmjF.36.4030 | metallo-peptidase, Clan MC, Family M14, putative | metallo-peptidase, Clan MC, Family M14, putative | | Q4Q112 | 36 | LmjF.36:1,537,914..1,542,575(+) | LmjF.36:1537914..1542575(+) | LmjF.36 | Leishmania major strain Friedlin | 50 | OG6_142418 | 0 | 1553 | 4662 | 165548 | 9.36 | 0 | NN: MSRPRDVKRKTAHPPSLASTATVASVSPIPVCAP, HMM: MSRPRDVKRKTAHPPSLASTATVASVSPI | NN Sum: 0, NN D: .1, HMM Prob: .7 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.4030ORmetallo-peptidase, Clan MC, Family M14, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.4030 OR metallo-peptidase, Clan MC, Family M14, putative AND Leishmania major strain Friedlin |
|
LmjF.36.4300 | LmjF.36.4300:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2250 | LmjF.36.4300 | trypanothione synthetase-like protein | trypanothione synthetase-like protein | | Q4Q0Y4 | 36 | LmjF.36:1,657,674..1,659,923(+) | LmjF.36:1657674..1659923(+) | LmjF.36 | Leishmania major strain Friedlin | 36 | OG6_173844 | 0 | 749 | 2250 | 82659 | 6.07 | 0 | | | | | | | | | | | | | | | 6.3.1.9 (Trypanothione synthase) | 6.3.1.9 (Trypanothione synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.4300ORtrypanothione synthetase-like proteinANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.4300 OR trypanothione synthetase-like protein AND Leishmania major strain Friedlin |
|
LmjF.36.4360 | LmjF.36.4360:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 1233 | LmjF.36.4360 | Regulatory particle triple-A ATPase subunit 6 | Regulatory particle triple-A ATPase subunit 6 | | Q4Q0X8 | 36 | LmjF.36:1,689,262..1,690,494(+) | LmjF.36:1689262..1690494(+) | LmjF.36 | Leishmania major strain Friedlin | 51 | OG6_101513 | 0 | 410 | 1233 | 45619 | 9.60 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654;GO:0005838 | cytoplasm;nucleoplasm;proteasome regulatory particle | GO:0016887 | ATPase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.4360ORRegulatory particle triple-A ATPase subunit 6ANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.4360 OR Regulatory particle triple-A ATPase subunit 6 AND Leishmania major strain Friedlin |
|
LmjF.36.4450 | LmjF.36.4450:mRNA | 1 | 1 | 1 | | | forward | protein coding | No | 2031 | LmjF.36.4450 | mitochondrial intermediate peptidase, putative | mitochondrial intermediate peptidase, putative | | Q4Q0W9 | 36 | LmjF.36:1,723,999..1,726,029(+) | LmjF.36:1723999..1726029(+) | LmjF.36 | Leishmania major strain Friedlin | 49 | OG6_102110 | 0 | 676 | 2031 | 76011 | 6.51 | 0 | NN: MLRRLVSCASPLRLRGCGAA, HMM: MLRRLVSCASPLRLRGCGAA | NN Sum: 1, NN D: .47, HMM Prob: .93 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.4450ORmitochondrial intermediate peptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.4450 OR mitochondrial intermediate peptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.36.5560 | LmjF.36.5560:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2523 | LmjF.36.5560 | aminopeptidase P1, putative | aminopeptidase P1, putative | | Q4Q0K5 | 36 | LmjF.36:2,150,466..2,152,988(-) | LmjF.36:2150466..2152988(-) | LmjF.36 | Leishmania major strain Friedlin | 27 | OG6_200380 | 0 | 840 | 2523 | 90728 | 7.36 | 0 | NN: MLRRAWRTAPAQRHSVSVTLGSTRWIGGSTAV, HMM: MLRRAWRTAPAQRHSVSVTLGSTRWIGGSTAV | NN Sum: 0, NN D: .21, HMM Prob: .9 | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.5560ORaminopeptidase P1, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.5560 OR aminopeptidase P1, putative AND Leishmania major strain Friedlin |
|
LmjF.36.6020 | LmjF.36.6020:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 807 | LmjF.36.6020 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | | Q4Q0F8 | 36 | LmjF.36:2,314,874..2,315,680(-) | LmjF.36:2314874..2315680(-) | LmjF.36 | Leishmania major strain Friedlin | 49 | OG6_102949 | 0 | 268 | 807 | 29817 | 6.92 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.6020OROTU-like cysteine protease, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.6020 OR OTU-like cysteine protease, putative AND Leishmania major strain Friedlin |
|
LmjF.36.6260 | LmjF.36.6260:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 1284 | LmjF.36.6260 | carboxypeptidase, putative | carboxypeptidase, putative | | Q4Q0D4 | 36 | LmjF.36:2,406,467..2,407,750(-) | LmjF.36:2406467..2407750(-) | LmjF.36 | Leishmania major strain Friedlin | 152 | OG6_105939 | 3 | 427 | 1284 | 48208 | 7.95 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.6260ORcarboxypeptidase, putativeANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.6260 OR carboxypeptidase, putative AND Leishmania major strain Friedlin |
|
LmjF.36.6750 | LmjF.36.6750:mRNA | 1 | 1 | 1 | | | reverse | protein coding | No | 2094 | LmjF.36.6750 | prolyl endopeptidase | prolyl endopeptidase | | Q4Q080 | 36 | LmjF.36:2,597,482..2,599,575(-) | LmjF.36:2597482..2599575(-) | LmjF.36 | Leishmania major strain Friedlin | 64 | OG6_101804 | 0 | 697 | 2094 | 78248 | 5.79 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0070012 | oligopeptidase activity | | | 3.4.21.26 (Prolyl oligopeptidase) | 3.4.21.26 (Prolyl oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmjF.36.6750ORprolyl endopeptidaseANDLeishmania major strain Friedlin | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmjF.36.6750 OR prolyl endopeptidase AND Leishmania major strain Friedlin |